PDB entry 3ndp

View 3ndp on RCSB PDB site
Description: Crystal structure of human AK4(L171P)
Class: transferase
Keywords: parallel beta-sheet, alpha-helices, transferase
Deposited on 2010-06-07, released 2010-06-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adenylate kinase isoenzyme 4
    Species: Homo sapiens [TaxId:9606]
    Gene: AK4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27144 (Start-222)
      • expression tag (223-230)
    Domains in SCOPe 2.07: d3ndpa1, d3ndpa2, d3ndpa3
  • Chain 'B':
    Compound: Adenylate kinase isoenzyme 4
    Species: Homo sapiens [TaxId:9606]
    Gene: AK4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27144 (Start-222)
      • expression tag (223-230)
    Domains in SCOPe 2.07: d3ndpb1, d3ndpb2, d3ndpb3
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ndpA (A:)
    maskllravilgppgsgkgtvcqriaqnfglqhlssghflrenikastevgemakqyiek
    sllvpdhvitrlmmselenrrgqhwlldgfprtlgqaealdkicevdlvislnipfetlk
    drlsrrwihppsgrvynldfnpphvhgiddvtgeplvqqeddkpeavaarprqykdvakp
    vielyksrgvlhqfsgtetnkiwpyvytlfsnkitpiqskeaylehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ndpA (A:)
    llravilgppgsgkgtvcqriaqnfglqhlssghflrenikastevgemakqyieksllv
    pdhvitrlmmselenrrgqhwlldgfprtlgqaealdkicevdlvislnipfetlkdrls
    rrwihppsgrvynldfnpphvhgiddvtgeplvqqedkdvakpvielyksrgvlhqfsgt
    etnkiwpyvytlfsnkitpiqskeaylehhhhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ndpB (B:)
    maskllravilgppgsgkgtvcqriaqnfglqhlssghflrenikastevgemakqyiek
    sllvpdhvitrlmmselenrrgqhwlldgfprtlgqaealdkicevdlvislnipfetlk
    drlsrrwihppsgrvynldfnpphvhgiddvtgeplvqqeddkpeavaarprqykdvakp
    vielyksrgvlhqfsgtetnkiwpyvytlfsnkitpiqskeaylehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ndpB (B:)
    kllravilgppgsgkgtvcqriaqnfglqhlssghflrenikastevgemakqyieksll
    vpdhvitrlmmselenrrgqhwlldgfprtlgqaealdkicevdlvislnirlsrrwihp
    psgrvynldfnpphvhgiddvtgeplvqqeddakpvielyksrgvlhqfsgtetnkiwpy
    vytlfsnkitpiqskeaylehhhhhh