PDB entry 3nbq

View 3nbq on RCSB PDB site
Description: Human uridine phosphorylase 1 (hUPP1) with 5-fluorouracil
Class: transferase
Keywords: nucleoside phosphorylase, 5-fluorouracil, chemotherapy, TRANSFERASE
Deposited on 2010-06-03, released 2010-10-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uridine phosphorylase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: UP, UPP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nbqa_
  • Chain 'B':
    Compound: Uridine phosphorylase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: UP, UPP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nbqb_
  • Chain 'C':
    Compound: Uridine phosphorylase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: UP, UPP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nbqc_
  • Chain 'D':
    Compound: Uridine phosphorylase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: UP, UPP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nbqd_
  • Heterogens: URF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nbqA (A:)
    mrgshhhhhhgspglqefmaatganaekaeshndcpvrllnpniakmkedilyhfnltts
    rhnfpalfgdvkfvcvggspsrmkafircvgaelgldcpgrdypnicagtdryamykvgp
    vlsvshgmgipsisimlhelikllyyarcsnvtiirigtsggiglepgtvviteqavdtc
    fkaefeqivlgkrvirktdlnkklvqelllcsaelsefttvvgntmctldfyegqgrldg
    alcsytekdkqayleaayaagvrniemessvfaamcsacglqaavvcvtllnrlegdqis
    sprnvlseyqqrpqrlvsyfikkklska
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nbqA (A:)
    dcpvrllnpniakmkedilyhfnlttsrhnfpalfgdvkfvcvggspsrmkafircvgae
    lgldcpgrdypnicagtdryamykvgpvlsvshgmgipsisimlhelikllyyarcsnvt
    iirigtsggiglepgtvviteqavdtcfkaefeqivlgkrvirktdlnkklvqelllcsa
    elsefttvvgntmctldfyegqgrldgalcsytekdkqayleaayaagvrniemessvfa
    amcsacglqaavvcvtllnrlegdqissprnvlseyqqrpqrlvsyfikkkls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nbqB (B:)
    mrgshhhhhhgspglqefmaatganaekaeshndcpvrllnpniakmkedilyhfnltts
    rhnfpalfgdvkfvcvggspsrmkafircvgaelgldcpgrdypnicagtdryamykvgp
    vlsvshgmgipsisimlhelikllyyarcsnvtiirigtsggiglepgtvviteqavdtc
    fkaefeqivlgkrvirktdlnkklvqelllcsaelsefttvvgntmctldfyegqgrldg
    alcsytekdkqayleaayaagvrniemessvfaamcsacglqaavvcvtllnrlegdqis
    sprnvlseyqqrpqrlvsyfikkklska
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nbqB (B:)
    dcpvrllnpniakmkedilyhfnlttsrhnfpalfgdvkfvcvggspsrmkafircvgae
    lgldcpgrdypnicagtdryamykvgpvlsvshgmgipsisimlhelikllyyarcsnvt
    iirigtsggiglepgtvviteqavdtcfkaefeqivlgkrvirktdlnkklvqelllcsa
    elsefttvvgntmctldfyegqgrldgalcsytekdkqayleaayaagvrniemessvfa
    amcsacglqaavvcvtllnrlegdqissprnvlseyqqrpqrlvsyfikkkls
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3nbqC (C:)
    mrgshhhhhhgspglqefmaatganaekaeshndcpvrllnpniakmkedilyhfnltts
    rhnfpalfgdvkfvcvggspsrmkafircvgaelgldcpgrdypnicagtdryamykvgp
    vlsvshgmgipsisimlhelikllyyarcsnvtiirigtsggiglepgtvviteqavdtc
    fkaefeqivlgkrvirktdlnkklvqelllcsaelsefttvvgntmctldfyegqgrldg
    alcsytekdkqayleaayaagvrniemessvfaamcsacglqaavvcvtllnrlegdqis
    sprnvlseyqqrpqrlvsyfikkklska
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nbqC (C:)
    dcpvrllnpniakmkedilyhfnlttsrhnfpalfgdvkfvcvggspsrmkafircvgae
    lgldcpgrdypnicagtdryamykvgpvlsvshgmgipsisimlhelikllyyarcsnvt
    iirigtsggiglepgtvviteqavdtcfkaefeqivlgkrvirktdlnkklvqelllcsa
    elsefttvvgntmctldfyegqgrldgalcsytekdkqayleaayaagvrniemessvfa
    amcsacglqaavvcvtllnrlegdqissprnvlseyqqrpqrlvsyfikkkls
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3nbqD (D:)
    mrgshhhhhhgspglqefmaatganaekaeshndcpvrllnpniakmkedilyhfnltts
    rhnfpalfgdvkfvcvggspsrmkafircvgaelgldcpgrdypnicagtdryamykvgp
    vlsvshgmgipsisimlhelikllyyarcsnvtiirigtsggiglepgtvviteqavdtc
    fkaefeqivlgkrvirktdlnkklvqelllcsaelsefttvvgntmctldfyegqgrldg
    alcsytekdkqayleaayaagvrniemessvfaamcsacglqaavvcvtllnrlegdqis
    sprnvlseyqqrpqrlvsyfikkklska
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nbqD (D:)
    dcpvrllnpniakmkedilyhfnlttsrhnfpalfgdvkfvcvggspsrmkafircvgae
    lgldcpgrdypnicagtdryamykvgpvlsvshgmgipsisimlhelikllyyarcsnvt
    iirigtsggiglepgtvviteqavdtcfkaefeqivlgkrvirktdlnkklvqelllcsa
    elsefttvvgntmctldfyegqgrldgalcsytekdkqayleaayaagvrniemessvfa
    amcsacglqaavvcvtllnrlegdqissprnvlseyqqrpqrlvsyfikkkls