PDB entry 3na1

View 3na1 on RCSB PDB site
Description: Crystal structure of human CYP11A1 in complex with 20-hydroxycholesterol
Class: Oxidoreductase, Electron transport
Keywords: cytochrome P450, 20-hydroxycholesterol, cholesterol side chain cleavage, Structural Genomics, Structural Genomics Consortium, SGC, Oxidoreductase, Electron transport
Deposited on 2010-05-31, released 2011-06-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-07-08.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.195
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Cholesterol side-chain cleavage enzyme, mitochondrial
  Species: Homo sapiens [TaxId:9606]
  Gene: CYP11A, CYP11A1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05108
• Chain 'B':
  Compound: Cholesterol side-chain cleavage enzyme, mitochondrial
  Species: Homo sapiens [TaxId:9606]
  Gene: CYP11A, CYP11A1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05108
• Chain 'C':
  Compound: Adrenodoxin, mitochondrial
  Species: Homo sapiens [TaxId:9606]
  Gene: adrenodoxin, ADX, FDX1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P10109
  Domains in SCOPe 2.05: d3na1c_
• Chain 'D':
  Compound: Adrenodoxin, mitochondrial
  Species: Homo sapiens [TaxId:9606]
  Gene: adrenodoxin, ADX, FDX1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P10109
  Domains in SCOPe 2.05: d3na1d_
• Heterogens: HEM, HCD, FES, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence, based on SEQRES records: (download)
  

  >3na1C (C:)
  ssedkitvhfinrdgetlttkgkvgdslldvvvennldidgfgacegtlacstchlifed
  hiyekldaitdeendmldlaygltdrsrlgcqicltksmdnmtvrvpetvadarqsidvg
  kts
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3na1C (C:)
  gacegtlacstcdeendmldlalgcq
  

  
  
• Chain 'D':
  Sequence, based on SEQRES records: (download)
  

  >3na1D (D:)
  ssedkitvhfinrdgetlttkgkvgdslldvvvennldidgfgacegtlacstchlifed
  hiyekldaitdeendmldlaygltdrsrlgcqicltksmdnmtvrvpetvadarqsidvg
  kts
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3na1D (D:)
  acegtlacstceendmldlalgcq