PDB entry 3n9z

View 3n9z on RCSB PDB site
Description: Crystal structure of human CYP11A1 in complex with 22-hydroxycholesterol
Class: Oxidoreductase, Electron transport
Keywords: cytochrome P450, 22-hydroxycholesterol, cholesterol side chain cleavage, Structural Genomics, Structural Genomics Consortium, SGC, Oxidoreductase, Electron transport
Deposited on 2010-05-31, released 2011-06-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-07-08.
Experiment type: XRAY
Resolution: 2.17 Å
R-factor: 0.211
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cholesterol side-chain cleavage enzyme
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP11A, CYP11A1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3n9za_
  • Chain 'B':
    Compound: Cholesterol side-chain cleavage enzyme
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP11A, CYP11A1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3n9zb_
  • Chain 'C':
    Compound: adrenodoxin
    Species: Homo sapiens [TaxId:9606]
    Gene: adrenodoxin, ADX, FDX1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3n9zc_
  • Chain 'D':
    Compound: adrenodoxin
    Species: Homo sapiens [TaxId:9606]
    Gene: adrenodoxin, ADX, FDX1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3n9zd_
  • Heterogens: HEM, HC9, FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3n9zA (A:)
    strsprpfneipspgdngwlnlyhfwretgthkvhlhhvqnfqkygpiyreklgnvesvy
    vidpedvallfksegpnperflippwvayhqyyqrpigvllkksaawkkdrvalnqevma
    peatknflplldavsrdfvsvlhrrikkagsgnysgdisddlfrfafesitnvifgerqg
    mleevvnpeaqrfidaiyqmfhtsvpmlnlppdlfrlfrtktwkdhvaawdvifskadiy
    tqnfywelrqkgsvhhdyrgilyrllgdskmsfedikanvtemlaggvdttsmtlqwhly
    emarnlkvqdmlraevlaarhqaqgdmatmlqlvpllkasiketlrlhpisvtlqrylvn
    dlvlrdymipaktlvqvaiyalgreptfffdpenfdptrwlskdknityfrnlgfgwgvr
    qclgrriaelemtiflinmlenfrveiqhlsdvgttfnlilmpekpisftfwpfnqeatq
    qhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n9zA (A:)
    prpfneipspgdngwlnlyhfwretgthkvhlhhvqnfqkygpiyreklgnvesvyvidp
    edvallfksegpnperflippwvayhqyyqrpigvllkksaawkkdrvalnqevmapeat
    knflplldavsrdfvsvlhrrikkagsgnysgdisddlfrfafesitnvifgerqgmlee
    vvnpeaqrfidaiyqmfhtsvpmlnlppdlfrlfrtktwkdhvaawdvifskadiytqnf
    ywelrqkgsvhhdyrgilyrllgdskmsfedikanvtemlaggvdttsmtlqwhlyemar
    nlkvqdmlraevlaarhqaqgdmatmlqlvpllkasiketlrlhpisvtlqrylvndlvl
    rdymipaktlvqvaiyalgreptfffdpenfdptrwlskdknityfrnlgfgwgvrqclg
    rriaelemtiflinmlenfrveiqhlsdvgttfnlilmpekpisftfwpf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3n9zB (B:)
    strsprpfneipspgdngwlnlyhfwretgthkvhlhhvqnfqkygpiyreklgnvesvy
    vidpedvallfksegpnperflippwvayhqyyqrpigvllkksaawkkdrvalnqevma
    peatknflplldavsrdfvsvlhrrikkagsgnysgdisddlfrfafesitnvifgerqg
    mleevvnpeaqrfidaiyqmfhtsvpmlnlppdlfrlfrtktwkdhvaawdvifskadiy
    tqnfywelrqkgsvhhdyrgilyrllgdskmsfedikanvtemlaggvdttsmtlqwhly
    emarnlkvqdmlraevlaarhqaqgdmatmlqlvpllkasiketlrlhpisvtlqrylvn
    dlvlrdymipaktlvqvaiyalgreptfffdpenfdptrwlskdknityfrnlgfgwgvr
    qclgrriaelemtiflinmlenfrveiqhlsdvgttfnlilmpekpisftfwpfnqeatq
    qhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n9zB (B:)
    prpfneipspgdngwlnlyhfwretgthkvhlhhvqnfqkygpiyreklgnvesvyvidp
    edvallfksegpnperflippwvayhqyyqrpigvllkksaawkkdrvalnqevmapeat
    knflplldavsrdfvsvlhrrikkagsgnysgdisddlfrfafesitnvifgerqgmlee
    vvnpeaqrfidaiyqmfhtsvpmlnlppdlfrlfrtktwkdhvaawdvifskadiytqnf
    ywelrqkgsvhhdyrgilyrllgdskmsfedikanvtemlaggvdttsmtlqwhlyemar
    nlkvqdmlraevlaarhqaqgdmatmlqlvpllkasiketlrlhpisvtlqrylvndlvl
    rdymipaktlvqvaiyalgreptfffdpenfdptrwlskdknityfrnlgfgwgvrqclg
    rriaelemtiflinmlenfrveiqhlsdvgttfnlilmpekpisftfwpf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3n9zC (C:)
    ssedkitvhfinrdgetlttkgkvgdslldvvvennldidgfgacegtlacstchlifed
    hiyekldaitdeendmldlaygltdrsrlgcqicltksmdnmtvrvpetvadarqsidvg
    kts
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n9zC (C:)
    gacegtlacstchldeendmldlrlgc
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3n9zD (D:)
    ssedkitvhfinrdgetlttkgkvgdslldvvvennldidgfgacegtlacstchlifed
    hiyekldaitdeendmldlaygltdrsrlgcqicltksmdnmtvrvpetvadarqsidvg
    kts
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n9zD (D:)
    gacegtlacstchldeendmldlrlgc