PDB entry 3n9g

View 3n9g on RCSB PDB site
Description: Crystal structure of the Fab fragment of the human neutralizing anti-West Nile Virus MAb CR4354
Class: immune system
Keywords: FAB fragment, human neutralizing antibody, MAb CR4354, immune system, anti-west nile virus
Deposited on 2010-05-29, released 2010-11-24
The last revision prior to the SCOPe 2.03 freeze date was dated 2010-11-24, with a file datestamp of 2010-11-19.
Experiment type: XRAY
Resolution: 1.43 Å
R-factor: 0.168
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab fragment of MAb CR4354, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3N9G (0-229)
  • Chain 'L':
    Compound: Fab fragment of MAb CR4354, light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3N9G (0-219)
    Domains in SCOPe 2.03: d3n9gl1, d3n9gl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3n9gL (L:)
qsvltqpssvsgtpgqrvtiscsgsssnigsntvnwyqqlpgtapklliygnnqrpsgvp
drfsgsksgtsaslaisglqsedeadyycaawddslngpvfgggtkltvlgaaagqpkaa
psvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnky
aassylsltpeqwkshrsyscqvthegstvektvaptecs