PDB entry 3n7k

View 3n7k on RCSB PDB site
Description: Crystal structure of botulinum neurotoxin serotype C1 binding domain
Class: toxin
Keywords: botulinum neurotoxin, Ganglioside GD1b, HCR/C, Ganglioside binding loop, TOXIN
Deposited on 2010-05-27, released 2010-09-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-01-28, with a file datestamp of 2015-01-23.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.223
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Botulinum neurotoxin type C1
    Species: Clostridium botulinum [TaxId:1491]
    Gene: clostridium phage c-st gene
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3n7ka1, d3n7ka2
  • Chain 'B':
    Compound: Botulinum neurotoxin type C1
    Species: Clostridium botulinum [TaxId:1491]
    Gene: clostridium phage c-st gene
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3n7kb1, d3n7kb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3n7kA (A:)
    nnindskilslqnrkntlvdtsgynaevseegdvqlnpifpfdfklgssgedrgkvivtq
    nenivynsmyesfsisfwirinkwvsnlpgytiidsvknnsgwsigiisnflvftlkqne
    dseqsinfsydisnnapgynkwffvtvtnnmmgnmkiyingklidtikvkeltginfskt
    itfeinkipdtglitsdsdninmwirdfyifakeldgkdinilfnslqytnvvkdywgnd
    lrynkeyymvnidylnrymyansrqivfntrrnnndfnegykiiikrirgntndtrvrgg
    dilyfdmtinnkaynlfmknetmyadnhstediyaiglreqtkdindniifqiqpmnnty
    yyasqifksnfngenisgicsigtyrfrlggdwyrhnylvptvkqgnyaslleststhwg
    fvpvse
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n7kA (A:)
    nindskilslqnrkntlvdtsgynaevseegdvqlnpifpfdfklgssgedrgkvivtqn
    enivynsmyesfsisfwirinkwvsnlpgytiidsvknnsgwsigiisnflvftlkqned
    seqsinfsydisnnapgynkwffvtvtnnmmgnmkiyingklidtikvkeltginfskti
    tfeinkipdtitsdsdninmwirdfyifakeldgkdinilfnslqytnvvkdywgndlry
    nkeyymvnidylnrymyansrqivfntrrnnndfnegykiiikrirgntndtrvrggdil
    yfdmtinnkaynlfmknetmyadnhstediyaiglreqtkdindniifqiqpmnntyyya
    sqifksnfngenisgicsigtyrfrlggdwyrhnylvptvkqgnyaslleststhwgfvp
    vs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3n7kB (B:)
    nnindskilslqnrkntlvdtsgynaevseegdvqlnpifpfdfklgssgedrgkvivtq
    nenivynsmyesfsisfwirinkwvsnlpgytiidsvknnsgwsigiisnflvftlkqne
    dseqsinfsydisnnapgynkwffvtvtnnmmgnmkiyingklidtikvkeltginfskt
    itfeinkipdtglitsdsdninmwirdfyifakeldgkdinilfnslqytnvvkdywgnd
    lrynkeyymvnidylnrymyansrqivfntrrnnndfnegykiiikrirgntndtrvrgg
    dilyfdmtinnkaynlfmknetmyadnhstediyaiglreqtkdindniifqiqpmnnty
    yyasqifksnfngenisgicsigtyrfrlggdwyrhnylvptvkqgnyaslleststhwg
    fvpvse
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n7kB (B:)
    nindskilslqnrkntlvdtsgynaevseegdvqlnpifpfdfklgssgedrgkvivtqn
    enivynsmyesfsisfwirinkwvsnlpgytiidsvknnsgwsigiisnflvftlkqned
    seqsinfsydisnnapgynkwffvtvtnnmmgnmkiyingklidtikvkeltginfskti
    tfeinkipditsdsdninmwirdfyifakeldgkdinilfnslqytnvvkdywgndlryn
    keyymvnidylnrymyansrqivfntrrnnndfnegykiiikrirgntndtrvrggdily
    fdmtinnkaynlfmknetmyadnhstediyaiglreqtkdindniifqiqpmnntyyyas
    qifksnfngenisgicsigtyrfrlggdwyrhnylvptvkqgnyaslleststhwgfvpv
    s