PDB entry 3n7j

View 3n7j on RCSB PDB site
Description: Crystal structure of botulinum neurotoxin serotype D binding domain
Class: toxin
Keywords: Botulinum Neurotoxin, HCR/D, Ganglioside Binding Loop, TOXIN
Deposited on 2010-05-27, released 2010-09-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-01-28, with a file datestamp of 2015-01-23.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.222
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Botulinum neurotoxin type D
    Species: Clostridium botulinum [TaxId:1491]
    Gene: botD, Clostridium phage d-16 phi
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n7ja1, d3n7ja2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3n7jA (A:)
    nsindskilslqnkknalvdtsgynaevrvgdnvqlntiytndfklsssgdkiivnlnnn
    ilysaiyenssvsfwikiskdltnshneytiinsieqnsgwklcirngniewilqdvnrk
    ykslifdyseslshtgytnkwffvtitnnimgymklyingelkqsqkiedldevkldkti
    vfgidenidenqmlwirdfnifskelsnedinivyegqilrnvikdywgnplkfdteyyi
    indnyidryiapesnvlvlvqypdrsklytgnpitiksvsdknpysrilngdniilhmly
    nsrkymiirdtdtiyatqggecsqncvyalklqsnlgnygigifsiknivsknkycsqif
    ssfrentmlladiykpwrfsfknaytpvavtnyetkllstssfwkfisrdpgwve
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n7jA (A:)
    nsindskilslqnkknalvdtsgynaevrvgdnvqlntiytndfklsssgdkiivnlnnn
    iliyenssvsfwikiskdltnshneytiinsieqnsgwklcirngniewilqdvnrkyks
    lifdyseslshtgytnkwffvtitnnimgymklyingelkqsqkiedldevkldktivfg
    idenidenqmlwirdfnifskelsnedinivyegqilrnvikdywgnplkfdteyyiind
    nyidryiapesnvlvlvqypdrsklytgnpitiksvsdknpysrilngdniilhmlynsr
    kymiirdtdtiyaqncvyalklqsnlgnygigifsiknivsknkycsqifssfrentmll
    adiykpwrfsfknaytpvavtnyetkllstssfwkfisrdpgwve