PDB entry 3n6j

View 3n6j on RCSB PDB site
Description: Crystal structure of Mandelate racemase/muconate lactonizing protein from Actinobacillus succinogenes 130Z
Class: isomerase
Keywords: STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, NEW YORK STRUCTURAL GENOMIX RESEARCH CONSORTIUM, NYSGXRC, enolase, PSI-2, ISOMERASE, New York SGX Research Center for Structural Genomics
Deposited on 2010-05-25, released 2010-07-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mandelate racemase/muconate lactonizing protein
    Species: Actinobacillus succinogenes [TaxId:339671]
    Gene: 152979509, Asuc_1852
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n6ja1, d3n6ja2
  • Chain 'B':
    Compound: Mandelate racemase/muconate lactonizing protein
    Species: Actinobacillus succinogenes [TaxId:339671]
    Gene: 152979509, Asuc_1852
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6VQF6 (Start-446)
      • expression tag (447-448)
    Domains in SCOPe 2.07: d3n6jb1, d3n6jb2, d3n6jb3
  • Chain 'C':
    Compound: Mandelate racemase/muconate lactonizing protein
    Species: Actinobacillus succinogenes [TaxId:339671]
    Gene: 152979509, Asuc_1852
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n6jc1, d3n6jc2
  • Chain 'D':
    Compound: Mandelate racemase/muconate lactonizing protein
    Species: Actinobacillus succinogenes [TaxId:339671]
    Gene: 152979509, Asuc_1852
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n6jd1, d3n6jd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3n6jA (A:)
    mslstqsvpvitdmkvipvaghdsmlmnvggahspyftrniviltdnsghtgvgeapgga
    tienalteaiphvvgrpisilnkivndmhngyldadydtfgkgawtfelrvnavaaleaa
    lldlmgqflgvpvaellgpgkqrdevtvlgylfyvgddkitdlpyqqpvtgkhewydirr
    kkamdtqavielaaaskdrygfkdfklkggvfegskeidtvielkkhfpdaritldpngc
    wsldeaiqlckglndvltyaedpcigengysgreimaefrrrtgiptatnmiatnwremc
    haimlqsvdipladphfwtltgasrvaqlcnewgltwgchsnnhfdislamfshvgaaap
    gnptaldthwiwqegdfyltknpleikdgkiklndkpglgielnmdnvlkahelhkklpn
    garndaipmqfyypgwkfdrkrpamvreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n6jA (A:)
    qsvpvitdmkvipvaghdsmlmnvggahspyftrniviltdnsghtgvgeapggatiena
    lteaiphvvgrpisilnkivndmhngyldadydtfgkgawtfelrvnavaaleaalldlm
    gqflgvpvaellgpgkqrdevtvlgylfyvgddkitdlpyqqpvtgkhewydirrkkamd
    tqavielaaaskdrygfkdfklkggvfegskeidtvielkkhfpdaritldpngcwslde
    aiqlckglndvltyaedpcigengysgreimaefrrrtgiptatnmiatnwremchaiml
    qsvdipladphfwtltgasrvaqlcnewgltwgchsnnhfdislamfshvgaaapgnpta
    ldthwiwqegdfyltknpleikdgkiklndkpglgielnmdnvlkahelhkklpngarnd
    aipmqfyypgwkfdrkrpamvr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3n6jB (B:)
    mslstqsvpvitdmkvipvaghdsmlmnvggahspyftrniviltdnsghtgvgeapgga
    tienalteaiphvvgrpisilnkivndmhngyldadydtfgkgawtfelrvnavaaleaa
    lldlmgqflgvpvaellgpgkqrdevtvlgylfyvgddkitdlpyqqpvtgkhewydirr
    kkamdtqavielaaaskdrygfkdfklkggvfegskeidtvielkkhfpdaritldpngc
    wsldeaiqlckglndvltyaedpcigengysgreimaefrrrtgiptatnmiatnwremc
    haimlqsvdipladphfwtltgasrvaqlcnewgltwgchsnnhfdislamfshvgaaap
    gnptaldthwiwqegdfyltknpleikdgkiklndkpglgielnmdnvlkahelhkklpn
    garndaipmqfyypgwkfdrkrpamvreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n6jB (B:)
    qsvpvitdmkvipvaghdsmlmnvggahspyftrniviltdnsghtgvgeapggatiena
    lteaiphvvgrpisilnkivndmhngywtfelrvnavaaleaalldlmgqflgvpvaell
    gpgkqrdevtvlgylfyvgddkitdlpyqqpvtgkhewydirrkkamdtqavielaaask
    drygfkdfklkggvfegskeidtvielkkhfpdaritldpngcwsldeaiqlckglndvl
    tyaedpcigengysgreimaefrrrtgiptatnmiatnwremchaimlqsvdipladphf
    wtltgasrvaqlcnewgltwgchsnnhfdislamfshvgaaapgnptaldthwiwqegdf
    yltknpleikdgkiklndkpglgielnmdnvlkahelhkklpngarndaipmqfyypgwk
    fdrkrpamvreg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3n6jC (C:)
    mslstqsvpvitdmkvipvaghdsmlmnvggahspyftrniviltdnsghtgvgeapgga
    tienalteaiphvvgrpisilnkivndmhngyldadydtfgkgawtfelrvnavaaleaa
    lldlmgqflgvpvaellgpgkqrdevtvlgylfyvgddkitdlpyqqpvtgkhewydirr
    kkamdtqavielaaaskdrygfkdfklkggvfegskeidtvielkkhfpdaritldpngc
    wsldeaiqlckglndvltyaedpcigengysgreimaefrrrtgiptatnmiatnwremc
    haimlqsvdipladphfwtltgasrvaqlcnewgltwgchsnnhfdislamfshvgaaap
    gnptaldthwiwqegdfyltknpleikdgkiklndkpglgielnmdnvlkahelhkklpn
    garndaipmqfyypgwkfdrkrpamvreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n6jC (C:)
    qsvpvitdmkvipvaghdsmlmnvggahspyftrniviltdnsghtgvgeapggatiena
    lteaiphvvgrpisilnkivndmhngyldadydtfgkgawtfelrvnavaaleaalldlm
    gqflgvpvaellgpgkqrdevtvlgylfyvgddkitdlpyqqpvtgkhewydirrkkamd
    tqavielaaaskdrygfkdfklkggvfegskeidtvielkkhfpdaritldpngcwslde
    aiqlckglndvltyaedpcigengysgreimaefrrrtgiptatnmiatnwremchaiml
    qsvdipladphfwtltgasrvaqlcnewgltwgchsnnhfdislamfshvgaaapgnpta
    ldthwiwqegdfyltknpleikdgkiklndkpglgielnmdnvlkahelhkklpngarnd
    aipmqfyypgwkfdrkrpamvr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3n6jD (D:)
    mslstqsvpvitdmkvipvaghdsmlmnvggahspyftrniviltdnsghtgvgeapgga
    tienalteaiphvvgrpisilnkivndmhngyldadydtfgkgawtfelrvnavaaleaa
    lldlmgqflgvpvaellgpgkqrdevtvlgylfyvgddkitdlpyqqpvtgkhewydirr
    kkamdtqavielaaaskdrygfkdfklkggvfegskeidtvielkkhfpdaritldpngc
    wsldeaiqlckglndvltyaedpcigengysgreimaefrrrtgiptatnmiatnwremc
    haimlqsvdipladphfwtltgasrvaqlcnewgltwgchsnnhfdislamfshvgaaap
    gnptaldthwiwqegdfyltknpleikdgkiklndkpglgielnmdnvlkahelhkklpn
    garndaipmqfyypgwkfdrkrpamvreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n6jD (D:)
    vpvitdmkvipvaghdsmlmnvggahspyftrniviltdnsghtgvgeapggatienalt
    eaiphvvgrpisilnkivndmhngyldadydtfgkgawtfelrvnavaaleaalldlmgq
    flgvpvaellgpgkqrdevtvlgylfyvgddkitdlpyqqpvtgkhewydirrkkamdtq
    avielaaaskdrygfkdfklkggvfegskeidtvielkkhfpdaritldpngcwsldeai
    qlckglndvltyaedpcigengysgreimaefrrrtgiptatnmiatnwremchaimlqs
    vdipladphfwtltgasrvaqlcnewgltwgchsnnhfdislamfshvgaaapgnptald
    thwiwqegdfyltknpleikdgkiklndkpglgielnmdnvlkahelhkklpngarndai
    pmqfyypgwkfdrkrpamvr