PDB entry 3n5m

View 3n5m on RCSB PDB site
Description: Crystals structure of a Bacillus anthracis aminotransferase
Class: transferase
Keywords: Aminotransferase, Bacillus anthracis, CSGID, Structural Genomics, Center for Structural Genomics of Infectious Diseases, TRANSFERASE
Deposited on 2010-05-25, released 2010-06-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-12-14, with a file datestamp of 2011-12-09.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.158
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adenosylmethionine-8-amino-7-oxononanoate aminotransferase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: BAS1519, BA_1636, GBAA1636, GBAA_1636
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6I0U5 (3-451)
      • expression tag (0-2)
      • see remark 999 (32)
      • see remark 999 (232)
    Domains in SCOPe 2.06: d3n5ma1, d3n5ma2
  • Chain 'B':
    Compound: Adenosylmethionine-8-amino-7-oxononanoate aminotransferase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: BAS1519, BA_1636, GBAA1636, GBAA_1636
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6I0U5 (3-451)
      • expression tag (2)
      • see remark 999 (32)
      • see remark 999 (232)
    Domains in SCOPe 2.06: d3n5mb1, d3n5mb2
  • Chain 'C':
    Compound: Adenosylmethionine-8-amino-7-oxononanoate aminotransferase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: BAS1519, BA_1636, GBAA1636, GBAA_1636
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6I0U5 (3-451)
      • expression tag (0-2)
      • see remark 999 (32)
      • see remark 999 (232)
    Domains in SCOPe 2.06: d3n5mc1, d3n5mc2
  • Chain 'D':
    Compound: Adenosylmethionine-8-amino-7-oxononanoate aminotransferase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: BAS1519, BA_1636, GBAA1636, GBAA_1636
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6I0U5 (3-451)
      • expression tag (1-2)
      • see remark 999 (32)
      • see remark 999 (232)
    Domains in SCOPe 2.06: d3n5md1, d3n5md2
  • Heterogens: SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3n5mA (A:)
    snamktkqtdellakdeqyvwhgmrpfspnsttvgakaegcwvediqgkryldgmsglwc
    vnsgygrkelaeaaykqlqtlsyfpmsqshepaiklaeklnewlggeyviffsnsgsean
    etafkiarqyyaqkgephrykfmsryrgyhgntmatmaatgqaqrryqyepfasgflhvt
    ppdcyrmpgiereniydvecvkevdrvmtwelsetiaafimepiitgggilmapqdymka
    vhetcqkhgallisdevicgfgrtgkafgfmnydvkpdiitmakgitsaylplsatavkr
    eiyeafkgkgeyeffrhintfggnpaacalalknleiienenliersaqmgsllleqlke
    eigehplvgdirgkgllvgielvndketkepidndkiasvvnackekgliigrngmttag
    ynniltlapplvisseeiafvigtlktameri
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3n5mB (B:)
    snamktkqtdellakdeqyvwhgmrpfspnsttvgakaegcwvediqgkryldgmsglwc
    vnsgygrkelaeaaykqlqtlsyfpmsqshepaiklaeklnewlggeyviffsnsgsean
    etafkiarqyyaqkgephrykfmsryrgyhgntmatmaatgqaqrryqyepfasgflhvt
    ppdcyrmpgiereniydvecvkevdrvmtwelsetiaafimepiitgggilmapqdymka
    vhetcqkhgallisdevicgfgrtgkafgfmnydvkpdiitmakgitsaylplsatavkr
    eiyeafkgkgeyeffrhintfggnpaacalalknleiienenliersaqmgsllleqlke
    eigehplvgdirgkgllvgielvndketkepidndkiasvvnackekgliigrngmttag
    ynniltlapplvisseeiafvigtlktameri
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n5mB (B:)
    amktkqtdellakdeqyvwhgmrpfspnsttvgakaegcwvediqgkryldgmsglwcvn
    sgygrkelaeaaykqlqtlsyfpmsqshepaiklaeklnewlggeyviffsnsgseanet
    afkiarqyyaqkgephrykfmsryrgyhgntmatmaatgqaqrryqyepfasgflhvtpp
    dcyrmpgiereniydvecvkevdrvmtwelsetiaafimepiitgggilmapqdymkavh
    etcqkhgallisdevicgfgrtgkafgfmnydvkpdiitmakgitsaylplsatavkrei
    yeafkgkgeyeffrhintfggnpaacalalknleiienenliersaqmgsllleqlkeei
    gehplvgdirgkgllvgielvndketkepidndkiasvvnackekgliigrngmttagyn
    niltlapplvisseeiafvigtlktameri
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3n5mC (C:)
    snamktkqtdellakdeqyvwhgmrpfspnsttvgakaegcwvediqgkryldgmsglwc
    vnsgygrkelaeaaykqlqtlsyfpmsqshepaiklaeklnewlggeyviffsnsgsean
    etafkiarqyyaqkgephrykfmsryrgyhgntmatmaatgqaqrryqyepfasgflhvt
    ppdcyrmpgiereniydvecvkevdrvmtwelsetiaafimepiitgggilmapqdymka
    vhetcqkhgallisdevicgfgrtgkafgfmnydvkpdiitmakgitsaylplsatavkr
    eiyeafkgkgeyeffrhintfggnpaacalalknleiienenliersaqmgsllleqlke
    eigehplvgdirgkgllvgielvndketkepidndkiasvvnackekgliigrngmttag
    ynniltlapplvisseeiafvigtlktameri
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3n5mD (D:)
    snamktkqtdellakdeqyvwhgmrpfspnsttvgakaegcwvediqgkryldgmsglwc
    vnsgygrkelaeaaykqlqtlsyfpmsqshepaiklaeklnewlggeyviffsnsgsean
    etafkiarqyyaqkgephrykfmsryrgyhgntmatmaatgqaqrryqyepfasgflhvt
    ppdcyrmpgiereniydvecvkevdrvmtwelsetiaafimepiitgggilmapqdymka
    vhetcqkhgallisdevicgfgrtgkafgfmnydvkpdiitmakgitsaylplsatavkr
    eiyeafkgkgeyeffrhintfggnpaacalalknleiienenliersaqmgsllleqlke
    eigehplvgdirgkgllvgielvndketkepidndkiasvvnackekgliigrngmttag
    ynniltlapplvisseeiafvigtlktameri
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n5mD (D:)
    namktkqtdellakdeqyvwhgmrpfspnsttvgakaegcwvediqgkryldgmsglwcv
    nsgygrkelaeaaykqlqtlsyfpmsqshepaiklaeklnewlggeyviffsnsgseane
    tafkiarqyyaqkgephrykfmsryrgyhgntmatmaatgqaqrryqyepfasgflhvtp
    pdcyrmpgiereniydvecvkevdrvmtwelsetiaafimepiitgggilmapqdymkav
    hetcqkhgallisdevicgfgrtgkafgfmnydvkpdiitmakgitsaylplsatavkre
    iyeafkgkgeyeffrhintfggnpaacalalknleiienenliersaqmgsllleqlkee
    igehplvgdirgkgllvgielvndketkepidndkiasvvnackekgliigrngmttagy
    nniltlapplvisseeiafvigtlktameri