PDB entry 3n5a

View 3n5a on RCSB PDB site
Description: Synaptotagmin-7, C2B-domain, calcium bound
Class: protein transport
Keywords: calcium/phospholipid binding protein, protein transport
Deposited on 2010-05-24, released 2010-09-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-10-20, with a file datestamp of 2010-10-15.
Experiment type: XRAY
Resolution: 1.44 Å
R-factor: 0.161
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Synaptotagmin-7
  Species: Mus musculus [TaxId:10090]
  Gene: SYT7
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9R0N7 (0-137)
  Domains in SCOPe 2.06: d3n5aa_
• Heterogens: CA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3n5aA (A:)
  srgelllslcynpsansiivniikarnlkamdiggtsdpyvkvwlmykdkrvekkktvtk
  krnlnpifnesfafdipteklrettiiitvmdkdklsrndvigkiylswksgpgevkhwk
  dmiarprqpvaqwhqlka