PDB entry 3n48

View 3n48 on RCSB PDB site
Description: Structural Analysis of R-state Greyhound Hemoglobin
Class: oxygen transport
Keywords: Greyhound, Hemoglobin, Oxygen-affinity, P50, Dog, OXYGEN TRANSPORT
Deposited on 2010-05-21, released 2010-06-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-11-17, with a file datestamp of 2010-11-12.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.19
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemoglobin subunit alpha
    Species: Canis lupus familiaris [TaxId:9615]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3n48a_
  • Chain 'B':
    Compound: Hemoglobin subunit beta
    Species: Canis lupus familiaris [TaxId:9615]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3n48b_
  • Heterogens: HEM, OXY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3n48A (A:)
    vlspadktnikstwdkigghagdyggealdrtfqsfpttktyfphfdlspgsaqvkahgk
    kvadalttavahlddlpgalsalsdlhayklrvdpvnfkllshcllvtlachhpteftpa
    vhasldkffaavstvltskyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3n48B (B:)
    vhltaeekslvsglwgkvnvdevggealgrllivypwtqrffdsfgdlstpdavmsnakv
    kahgkkvlnsfsdglknldnlkgtfaklselhcdklhvdpenfkllgnvlvcvlahhfgk
    eftpqvqaayqkvvagvanalahkyh