PDB entry 3n44

View 3n44 on RCSB PDB site
Description: Crystal structure of the mature envelope glycoprotein complex (trypsin cleavage; Osmium soak) of Chikungunya virus.
Class: viral protein
Keywords: viral protein, immature heterodimer, alphavirus, receptor binding, membrane fusion
Deposited on 2010-05-21, released 2010-12-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-12-15, with a file datestamp of 2010-12-10.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.231
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 envelope glycoprotein
    Species: Chikungunya virus [TaxId:37124]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: e2 envelope glycoprotein
    Species: Chikungunya virus [TaxId:37124]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: e1 envelope glycoprotein
    Species: Chikungunya virus [TaxId:37124]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3n44f1, d3n44f2
  • Heterogens: ACT, NAG, OS, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3n44F (F:)
    elyggggsggggsggggsggggyehvtvipntvgvpyktlvnrpgyspmvlemellsvtl
    eptlsldyitceyktvipspyvkccgtaeckdknlpdysckvftgvypfmwggaycfcda
    entqlseahveksescktefasayrahtasasaklrvlyqgnnitvtayangdhavtvkd
    akfivgpmssawtpfdnkivvykgdvynmdyppfgagrpgqfgdiqsrtpeskdvyantq
    lvlqrpaagtvhvpysqapsgfkywlkergaslqhtapfgcqiatnpvravncavgnmpi
    sidipeaaftrvvdapsltdmscevpacthssdfggvaiikyaaskkgkcavhsmtnavt
    ireaeievegnsqlqisfstalasaefrvqvcstqvhcaaechppkdhivnypashttlg
    vqdisatamswvqkgpfeddddkagwshpqfekgggsgggsgggswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n44F (F:)
    yehvtvipntvgvpyktlvnrpgyspmvlemellsvtleptlsldyitceyktvipspyv
    kccgtaeckdknlpdysckvftgvypfmwggaycfcdaentqlseahveksescktefas
    ayrahtasasaklrvlyqgnnitvtayangdhavtvkdakfivgpmssawtpfdnkivvy
    kgdvynmdyppfgagrpgqfgdiqsrtpeskdvyantqlvlqrpaagtvhvpysqapsgf
    kywlkergaslqhtapfgcqiatnpvravncavgnmpisidipeaaftrvvdapsltdms
    cevpacthssdfggvaiikyaaskkgkcavhsmtnavtireaeievegnsqlqisfstal
    asaefrvqvcstqvhcaaechppkdhivnyp