PDB entry 3n40

View 3n40 on RCSB PDB site
Description: Crystal structure of the immature envelope glycoprotein complex of Chikungunya virus.
Class: viral protein
Keywords: viral protein, immature heterodimer, alphavirus, receptor binding, membrane fusion
Deposited on 2010-05-21, released 2010-12-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-04-11, with a file datestamp of 2012-04-06.
Experiment type: XRAY
Resolution: 2.17 Å
R-factor: 0.209
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'F':
    Compound: e1 envelope glycoprotein
    Species: Chikungunya virus [TaxId:37124]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1H8W5 (2-392)
      • see remark 999 (0-1)
    Domains in SCOPe 2.05: d3n40f1, d3n40f2
  • Chain 'P':
    Compound: P62 envelope glycoprotein
    Species: Chikungunya virus [TaxId:37124]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1H8W5 (0-400)
      • engineered mutation (59)
  • Heterogens: NAG, ACT, HOH

PDB Chain Sequences:

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3n40F (F:)
ggyehvtvipntvgvpyktlvnrpgyspmvlemellsvtleptlsldyitceyktvipsp
yvkccgtaeckdknlpdysckvftgvypfmwggaycfcdaentqlseahveksescktef
asayrahtasasaklrvlyqgnnitvtayangdhavtvkdakfivgpmssawtpfdnkiv
vykgdvynmdyppfgagrpgqfgdiqsrtpeskdvyantqlvlqrpaagtvhvpysqaps
gfkywlkergaslqhtapfgcqiatnpvravncavgnmpisidipeaaftrvvdapsltd
mscevpacthssdfggvaiikyaaskkgkcavhsmtnavtireaeievegnsqlqisfst
alasaefrvqvcstqvhcaaechppkdhivnyp

  • Chain 'P':
    No sequence available.