PDB entry 3n2e

View 3n2e on RCSB PDB site
Description: Crystal structure of Helicobactor pylori shikimate kinase in complex with NSC162535
Class: transferase
Keywords: alpha-beta-alpha fold, TRANSFERASE
Deposited on 2010-05-18, released 2011-05-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-30, with a file datestamp of 2012-05-25.
Experiment type: XRAY
Resolution: 2.53 Å
R-factor: 0.219
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Shikimate kinase
    Species: HELICOBACTER PYLORI [TaxId:85962]
    Gene: AroK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56073 (0-161)
      • engineered mutation (113)
      • expression tag (162-167)
    Domains in SCOPe 2.07: d3n2ea1, d3n2ea2
  • Chain 'B':
    Compound: Shikimate kinase
    Species: HELICOBACTER PYLORI [TaxId:85962]
    Gene: AroK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56073 (0-161)
      • engineered mutation (113)
    Domains in SCOPe 2.07: d3n2eb_
  • Chain 'C':
    Compound: Shikimate kinase
    Species: HELICOBACTER PYLORI [TaxId:85962]
    Gene: AroK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56073 (0-161)
      • expression tag (162-166)
    Domains in SCOPe 2.07: d3n2ec1, d3n2ec2
  • Heterogens: OSA, TLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3n2eA (A:)
    mqhlvligfmgsgksslaqelglalklevldtdmiiservglsvreifeelgednfrmfe
    knlidelktlktphvistgggivmhenlkglgttfylkmdfetlikrlnqkerakrplln
    nltqakelfekrqalyeknasfiidargglnnslkqvlqfialqpsls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3n2eB (B:)
    mqhlvligfmgsgksslaqelglalklevldtdmiiservglsvreifeelgednfrmfe
    knlidelktlktphvistgggivmhenlkglgttfylkmdfetlikrlnqkerakrplln
    nltqakelfekrqalyeknasfiidargglnnslkqvlqfialqpsls
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n2eB (B:)
    mqhlvligfmgsgksslaqelglalklevldtdmiiservglsvreifeelgednfrmfe
    knlidelktlktphvistgggivmhenlkglgttfylkmdfetlikrlnqkerakrplln
    nltqakelfekrqalyeknasfiidargglnnslkqvlqfia
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3n2eC (C:)
    mqhlvligfmgsgksslaqelglalklevldtdmiiservglsvreifeelgednfrmfe
    knlidelktlktphvistgggivmhenlkglgttfylkmdfetlikrlnqkerakrplln
    nltqakelfekrqalyeknasfiidargglnnslkqvlqfialqpsls
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n2eC (C:)
    mqhlvligfmgsgksslaqelglalklevldtdmiiservglsvreifeelgednfrmfe
    knlidelktlktphvistgggivmhenlkglgttfylkmdalyeknasfiidargglnns
    lkqvlqfialqpsl