PDB entry 3n0e

View 3n0e on RCSB PDB site
Description: Crystal structure of WDR5 mutant (W330Y)
Class: Transcription
Keywords: WDR5, WD-repeat protein 5, Asp-His-Ser-Trp tetrad, Thermostability, circular dichroism, folding energy, guanidine hydrochloride, Transcription
Deposited on 2010-05-13, released 2010-10-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-12-01, with a file datestamp of 2010-11-26.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.222
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: WD repeat-containing protein 5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61964 (11-314)
      • expression tag (0-10)
      • engineered mutation (310)
    Domains in SCOPe 2.08: d3n0ea1, d3n0ea2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3n0eA (A:)
    ggqqmgrgsefvkpnyalkftlaghtkavssvkfspngewlasssadklikiwgaydgkf
    ektisghklgisdvawssdsnllvsasddktlkiwdvssgkclktlkghsnyvfccnfnp
    qsnlivsgsfdesvriwdvktgkclktlpahsdpvsavhfnrdgslivsssydglcriwd
    tasgqclktlidddnppvsfvkfspngkyilaatldntlklwdyskgkclktytghknek
    ycifanfsvtggkwivsgsednlvyiwnlqtkeivqklqghtdvvistachpteniiasa
    alendktiklyksdc