PDB entry 3mzt

View 3mzt on RCSB PDB site
Description: Protein-induced photophysical changes to the amyloid indicator dye, thioflavin T
Class: immune system
Keywords: Thioflavin T, amyloid, Parkinson's, Alzheimer's, IMMUNE SYSTEM
Deposited on 2010-05-13, released 2010-09-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-05-09, with a file datestamp of 2012-05-04.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.24
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Beta-2-microglobulin
  Species: Homo sapiens [TaxId:9606]
  Gene: B2M, CDABP0092, HDCMA22P
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61769 (1-99)
    • initiating methionine (0)
    • engineered mutant (13)
  Domains in SCOPe 2.05: d3mzta_
• Chain 'B':
  Compound: Beta-2-microglobulin
  Species: Homo sapiens [TaxId:9606]
  Gene: B2M, CDABP0092, HDCMA22P
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61769 (1-99)
    • initiating methionine (0)
    • engineered mutant (13)
  Domains in SCOPe 2.05: d3mztb_
• Chain 'C':
  Compound: Beta-2-microglobulin
  Species: Homo sapiens [TaxId:9606]
  Gene: B2M, CDABP0092, HDCMA22P
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61769 (1-99)
    • initiating methionine (0)
    • engineered mutant (13)
  Domains in SCOPe 2.05: d3mztc_
• Chain 'D':
  Compound: Beta-2-microglobulin
  Species: Homo sapiens [TaxId:9606]
  Gene: B2M, CDABP0092, HDCMA22P
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61769 (1-99)
    • initiating methionine (0)
    • engineered mutant (13)
  Domains in SCOPe 2.05: d3mztd_
• Chain 'E':
  Compound: Beta-2-microglobulin
  Species: Homo sapiens [TaxId:9606]
  Gene: B2M, CDABP0092, HDCMA22P
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61769 (1-99)
    • initiating methionine (0)
    • engineered mutant (13)
  Domains in SCOPe 2.05: d3mzte_
• Chain 'F':
  Compound: Beta-2-microglobulin
  Species: Homo sapiens [TaxId:9606]
  Gene: B2M, CDABP0092, HDCMA22P
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61769 (1-99)
    • initiating methionine (0)
    • engineered mutant (13)
  Domains in SCOPe 2.05: d3mztf_
• Heterogens: CU, TFX, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3mztA (A:)
  miqrtpkiqvysrfpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
  wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3mztB (B:)
  miqrtpkiqvysrfpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
  wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3mztC (C:)
  miqrtpkiqvysrfpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
  wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3mztD (D:)
  miqrtpkiqvysrfpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
  wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
  

  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3mztE (E:)
  miqrtpkiqvysrfpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
  wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
  

  
  
• Chain 'F':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3mztF (F:)
  miqrtpkiqvysrfpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
  wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm