PDB entry 3myz

View 3myz on RCSB PDB site
Description: Protein induced photophysical changes to the amyloid indicator dye, thioflavin T
Class: immune system
Keywords: amyloid, Thioflavin T, Parkinson's, Alzheimer's, beta-2 microglobulin, IMMUNE SYSTEM
Deposited on 2010-05-11, released 2010-09-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-10-13, with a file datestamp of 2010-10-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.191
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-2-microglobulin
    Species: Homo sapiens [TaxId:9606]
    Gene: B2M, CDABP0092, HDCMA22P
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61769 (1-End)
      • initiating methionine (0)
      • engineered mutation (13)
    Domains in SCOPe 2.04: d3myza_
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: Homo sapiens [TaxId:9606]
    Gene: B2M, CDABP0092, HDCMA22P
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61769 (1-End)
      • initiating methionine (0)
      • engineered mutation (13)
    Domains in SCOPe 2.04: d3myzb_
  • Heterogens: HG, TFX, TLA, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3myzA (A:)
miqrtpkiqvysrfpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm

    Sequence, based on observed residues (ATOM records): (download) 
    >3myzA (A:)
miqrtpkiqvysrfpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
sfyllyyteftptekdeyacrvnhvtlsqpkivkwdr

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3myzB (B:)
miqrtpkiqvysrfpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm

    Sequence, based on observed residues (ATOM records): (download) 
    >3myzB (B:)
miqrtpkiqvysrfpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdr