PDB entry 3mws

View 3mws on RCSB PDB site
Description: Crystal Structure of Group N HIV-1 Protease
Class: Hydrolase/Hydrolase Inhibitor
Keywords: HIV-1, Hydrolase-Hydrolase Inhibitor complex
Deposited on 2010-05-06, released 2011-03-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-03-30, with a file datestamp of 2011-03-25.
Experiment type: XRAY
Resolution: 1.09 Å
R-factor: 0.167
AEROSPACI score: 0.89 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: GAG, POL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q673V0
      • engineered (94)
    Domains in SCOPe 2.08: d3mwsa_
  • Chain 'B':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: GAG, POL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q673V0 (0-98)
      • engineered (94)
    Domains in SCOPe 2.08: d3mwsb_
  • Heterogens: CL, 017, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mwsA (A:)
    pqitlwqrpvitvkigkevrealldtgaddtvieeiqlegkwkpkmiggiggfikvrqyd
    nvtidiqgrkavgtvlvgptpvniigrnfltqigatlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mwsB (B:)
    pqitlwqrpvitvkigkevrealldtgaddtvieeiqlegkwkpkmiggiggfikvrqyd
    nvtidiqgrkavgtvlvgptpvniigrnfltqigatlnf