PDB entry 3mwm

View 3mwm on RCSB PDB site
Description: Graded expression of zinc-responsive genes through two regulatory zinc-binding sites in Zur
Class: transcription
Keywords: Fur, Zur, regulatory metal, graded transcription regulation, TRANSCRIPTION
Deposited on 2010-05-06, released 2011-03-16
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-03-16, with a file datestamp of 2011-03-11.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.206
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative metal uptake regulation protein
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: zur gene
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3mwma_
  • Chain 'B':
    Compound: Putative metal uptake regulation protein
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: zur gene
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3mwmb_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mwmA (A:)
    vttagppvkgratrqraavsaalqeveefrsaqelhdmlkhkgdavglttvyrtlqslad
    agevdvlrtaegesvyrrcstgdhhhhlvcracgkavevegpavekwaeaiaaehgyvnv
    ahtveifgtcadcagasgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mwmA (A:)
    gratrqraavsaalqeveefrsaqelhdmlkhkgdavglttvyrtlqsladagevdvlrt
    aegesvyrrcstgdhhhhlvcracgkavevegpavekwaeaiaaehgyvnvahtveifgt
    cadcaga
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mwmB (B:)
    vttagppvkgratrqraavsaalqeveefrsaqelhdmlkhkgdavglttvyrtlqslad
    agevdvlrtaegesvyrrcstgdhhhhlvcracgkavevegpavekwaeaiaaehgyvnv
    ahtveifgtcadcagasgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mwmB (B:)
    ratrqraavsaalqeveefrsaqelhdmlkhkgdavglttvyrtlqsladagevdvlrta
    egesvyrrcstgdhhhhlvcracgkavevegpavekwaeaiaaehgyvnvahtveifgtc
    adcag