PDB entry 3mug

View 3mug on RCSB PDB site
Description: Crystal structure of human Fab PG16, a broadly reactive and potent HIV-1 neutralizing antibody
Class: immune system
Keywords: PG16, Fab, sulfotyrosine, HIV, immune system
Deposited on 2010-05-03, released 2010-06-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Antibody PG16 Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MUG
    Domains in SCOPe 2.07: d3muga1, d3muga2
  • Chain 'B':
    Compound: Antibody PG16 Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MUG (0-End)
  • Chain 'C':
    Compound: Antibody PG16 Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MUG
    Domains in SCOPe 2.07: d3mugc1, d3mugc2
  • Chain 'D':
    Compound: Antibody PG16 Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MUG (0-End)
  • Chain 'E':
    Compound: Antibody PG16 Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MUG
    Domains in SCOPe 2.07: d3muge1, d3muge2
  • Chain 'F':
    Compound: Antibody PG16 Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MUG (0-End)
  • Chain 'G':
    Compound: Antibody PG16 Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MUG
    Domains in SCOPe 2.07: d3mugg1, d3mugg2
  • Chain 'H':
    Compound: Antibody PG16 Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MUG (0-End)
  • Chain 'I':
    Compound: Antibody PG16 Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MUG (0-End)
    Domains in SCOPe 2.07: d3mugi1, d3mugi2
  • Chain 'J':
    Compound: Antibody PG16 Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MUG (0-End)
  • Chain 'K':
    Compound: Antibody PG16 Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MUG
    Domains in SCOPe 2.07: d3mugk1, d3mugk2
  • Chain 'L':
    Compound: Antibody PG16 Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MUG (0-End)
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mugA (A:)
    esaltqpasvsgspgqtitiscngtssdvggfdsvswyqqspgkapkvmvfdvshrpsgi
    snrfsgsksgntasltisglhiedegdyfcssltdrshrifgggtkvtvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshksyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mugA (A:)
    saltqpasvsgspgqtitiscngtssdvggfdsvswyqqspgkapkvmvfdvshrpsgis
    nrfsgsksgntasltisglhiedegdyfcssltdrshrifgggtkvtvlgqpkaapsvtl
    fppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassy
    lsltpeqwkshksyscqvthegstvektvapt
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3mugC (C:)
    esaltqpasvsgspgqtitiscngtssdvggfdsvswyqqspgkapkvmvfdvshrpsgi
    snrfsgsksgntasltisglhiedegdyfcssltdrshrifgggtkvtvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshksyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mugC (C:)
    saltqpasvsgspgqtitiscngtssdvggfdsvswyqqspgkapkvmvfdvshrpsgis
    nrfsgsksgntasltisglhiedegdyfcssltdrshrifgggtkvtvlgqpkaapsvtl
    fppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassy
    lsltpeqwkshksyscqvthegstvektvapt
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3mugE (E:)
    esaltqpasvsgspgqtitiscngtssdvggfdsvswyqqspgkapkvmvfdvshrpsgi
    snrfsgsksgntasltisglhiedegdyfcssltdrshrifgggtkvtvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshksyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mugE (E:)
    altqpasvsgspgqtitiscngtssdvggfdsvswyqqspgkapkvmvfdvshrpsgisn
    rfsgsksgntasltisglhiedegdyfcssltdrshrifgggtkvtvlgqpkaapsvtlf
    ppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyl
    sltpeqwkshksyscqvthegstvektvapt
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3mugG (G:)
    esaltqpasvsgspgqtitiscngtssdvggfdsvswyqqspgkapkvmvfdvshrpsgi
    snrfsgsksgntasltisglhiedegdyfcssltdrshrifgggtkvtvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshksyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mugG (G:)
    saltqpasvsgspgqtitiscngtssdvggfdsvswyqqspgkapkvmvfdvshrpsgis
    nrfsgsksgntasltisglhiedegdyfcssltdrshrifgggtkvtvlgqpkaapsvtl
    fppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassy
    lsltpeqwkshksyscqvthegstvektvapt
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3mugI (I:)
    esaltqpasvsgspgqtitiscngtssdvggfdsvswyqqspgkapkvmvfdvshrpsgi
    snrfsgsksgntasltisglhiedegdyfcssltdrshrifgggtkvtvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshksyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mugI (I:)
    esaltqpasvsgspgqtitiscngtssdvggfdsvswyqqspgkapkvmvfdvshrpsgi
    snrfsgsksgntasltisglhiedegdyfcssltdrshrifgggtkvtvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshksyscqvthegstvektvapt
    

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3mugK (K:)
    esaltqpasvsgspgqtitiscngtssdvggfdsvswyqqspgkapkvmvfdvshrpsgi
    snrfsgsksgntasltisglhiedegdyfcssltdrshrifgggtkvtvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshksyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mugK (K:)
    altqpasvsgspgqtitiscngtssdvggfdsvswyqqspgkapkvmvfdvshrpsgisn
    rfsgsksgntasltisglhiedegdyfcssltdrshrifgggtkvtvlgqpkaapsvtlf
    ppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyl
    sltpeqwkshksyscqvthegstvektvapte
    

  • Chain 'L':
    No sequence available.