PDB entry 3mqk

View 3mqk on RCSB PDB site
Description: Cbf5-Nop10-Gar1 complex binding with 17mer RNA containing ACA trinucleotide
Class: Isomerase/RNA binding protein/rna
Keywords: Protein-RNA complex, Box H/ACA, pseudouridine synthase, post-transcriptional modification, Isomerase, tRNA processing, RNA-binding, Isomerase-RNA binding protein-rna complex
Deposited on 2010-04-28, released 2010-12-29
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-02-02, with a file datestamp of 2011-01-28.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.19
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tRNA pseudouridine synthase B
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: truB, PF1785
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Ribosome biogenesis protein Nop10
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: PF1141
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3mqkb_
  • Chain 'C':
    Compound: Small nucleolar rnp gar1-like protein
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: PF1791
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3mqkc_
  • Chain 'D':
    Compound: RNA (5'-r(p*gp*up*up*cp*gp*ap*up*cp*cp*ap*cp*ap*g)-3')
  • Chain 'E':
    Compound: RNA (5'-r(p*cp*gp*ap*up*cp*cp*ap*cp*a)-3')

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mqkB (B:)
    rirkcpkcgrytlkevcpvcgektkvahpprfspedpygeyrrrwkrevlgi
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mqkC (C:)
    mkrlgkvlhyakqgflivrtnwvpslndrvvdkrlqfvgivkdvfgpvkmpyvaikpkvs
    npeiyvgevlyvder
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.