PDB entry 3mpj

View 3mpj on RCSB PDB site
Description: Structure of the glutaryl-coenzyme A dehydrogenase
Class: oxidoreductase
Keywords: alpha-beta fold, OXIDOREDUCTASE
Deposited on 2010-04-27, released 2010-08-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-09-05, with a file datestamp of 2012-08-31.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.183
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutaryl-CoA dehydrogenase
    Species: Desulfococcus multivorans [TaxId:897]
    Gene: acd, gi228015642
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3mpja1, d3mpja2
  • Chain 'B':
    Compound: Glutaryl-CoA dehydrogenase
    Species: Desulfococcus multivorans [TaxId:897]
    Gene: acd, gi228015642
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3UVB0 (0-388)
      • expression tag (389-392)
    Domains in SCOPe 2.06: d3mpjb1, d3mpjb2, d3mpjb3
  • Chain 'D':
    Compound: Glutaryl-CoA dehydrogenase
    Species: Desulfococcus multivorans [TaxId:897]
    Gene: acd, gi228015642
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3UVB0 (0-388)
      • expression tag (389)
    Domains in SCOPe 2.06: d3mpjd1, d3mpjd2, d3mpjd3
  • Chain 'E':
    Compound: Glutaryl-CoA dehydrogenase
    Species: Desulfococcus multivorans [TaxId:897]
    Gene: acd, gi228015642
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3UVB0 (0-388)
      • expression tag (389-390)
    Domains in SCOPe 2.06: d3mpje1, d3mpje2, d3mpje3
  • Chain 'F':
    Compound: Glutaryl-CoA dehydrogenase
    Species: Desulfococcus multivorans [TaxId:897]
    Gene: acd, gi228015642
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3UVB0 (0-388)
      • expression tag (389)
    Domains in SCOPe 2.06: d3mpjf1, d3mpjf2, d3mpjf3
  • Chain 'G':
    Compound: Glutaryl-CoA dehydrogenase
    Species: Desulfococcus multivorans [TaxId:897]
    Gene: acd, gi228015642
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3mpjg1, d3mpjg2
  • Chain 'Y':
    Compound: Octapeptide
    Species: Desulfococcus multivorans [TaxId:897]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MPJ (0-7)
  • Heterogens: FAD, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mpjA (A:)
    mdfnlskelqmlqkevrnfvnkkivpfadqwdnenhfpyeeavrpmgelgffgtvipeey
    ggegmdqgwlaamivteeiargssalrvqlnmevlgcaytiltygsealkkkyvpklssa
    eflggfgitepdagsdvmamsstaedkgdhwllngsktwisnaaqadvliyyaytdkaag
    srglsafvieprnfpgiktsnleklgshasptgelfldnvkvpkenilgkpgdgarivfg
    slnhtrlsaaaggvglaqacldaaikycnerrqfgkpigdfqmnqdmiaqmaveveaarl
    laykaaaakdegrlnngldvamakyaageavskcanyamrilgaygysteypvarfyrda
    ptyymvegsanickmiialdqlgvrkanrkghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mpjA (A:)
    mdfnlskelqmlqkevrnfvnkkivpfadqwdnenhfpyeeavrpmgelgffgtvipeey
    ggegmdqgwlaamivteeiargssalrvqlnmevlgcaytiltygsealkkkyvpklssa
    eflggfgitepdagsdvmamsstaedkgdhwllngsktwisnaaqadvliyyaytdkaag
    srglsafvieprnfpgiktsnleklgshasptgelfldnvkvpkenilgkpgdgarivfg
    slnhtrlsaaaggvglaqacldaaikycnerrqfgkpigdfqmnqdmiaqmaveveaarl
    laykaaaakdegrlnngldvamakyaageavskcanyamrilgaygysteypvarfyrda
    ptyymvegsanickmiialdqlgvrkanr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mpjB (B:)
    mdfnlskelqmlqkevrnfvnkkivpfadqwdnenhfpyeeavrpmgelgffgtvipeey
    ggegmdqgwlaamivteeiargssalrvqlnmevlgcaytiltygsealkkkyvpklssa
    eflggfgitepdagsdvmamsstaedkgdhwllngsktwisnaaqadvliyyaytdkaag
    srglsafvieprnfpgiktsnleklgshasptgelfldnvkvpkenilgkpgdgarivfg
    slnhtrlsaaaggvglaqacldaaikycnerrqfgkpigdfqmnqdmiaqmaveveaarl
    laykaaaakdegrlnngldvamakyaageavskcanyamrilgaygysteypvarfyrda
    ptyymvegsanickmiialdqlgvrkanrkghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mpjB (B:)
    mdfnlskelqmlqkevrnfvnkkivpfadqwdnenhfpyeeavrpmgelgffgtvipeey
    ggegmdqgwlaamivteeiargssalrvqlnmevlgcaytiltygsealkkkyvpklssa
    eflggfgitepdagsdvmamsstaedkgdhwllngsktwisnaaqadvliyyaytdkaag
    srglsafvieprnfpgiktsnleklgshasptgelfldnvkvpkenilgkpgdgarivfg
    slnhtrlsaaaggvglaqacldaaikycnerrqfgkpigdfqmnqdmiaqmaveveaarl
    laykaaaakdegrlnngldvamakyaageavskcanyamrilgaygysteypvarfyrda
    ptyymvegsanickmiialdqlgvrkanrkghh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3mpjD (D:)
    mdfnlskelqmlqkevrnfvnkkivpfadqwdnenhfpyeeavrpmgelgffgtvipeey
    ggegmdqgwlaamivteeiargssalrvqlnmevlgcaytiltygsealkkkyvpklssa
    eflggfgitepdagsdvmamsstaedkgdhwllngsktwisnaaqadvliyyaytdkaag
    srglsafvieprnfpgiktsnleklgshasptgelfldnvkvpkenilgkpgdgarivfg
    slnhtrlsaaaggvglaqacldaaikycnerrqfgkpigdfqmnqdmiaqmaveveaarl
    laykaaaakdegrlnngldvamakyaageavskcanyamrilgaygysteypvarfyrda
    ptyymvegsanickmiialdqlgvrkanrkghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mpjD (D:)
    mdfnlskelqmlqkevrnfvnkkivpfadqwdnenhfpyeeavrpmgelgffgtvipeey
    ggegmdqgwlaamivteeiargssalrvqlnmevlgcaytiltygsealkkkyvpklssa
    eflggfgitepdagsdvmamsstaedkgdhwllngsktwisnaaqadvliyyaytdkaag
    srglsafvieprnfpgiktsnleklgshasptgelfldnvkvpkenilgkpgdgarivfg
    slnhtrlsaaaggvglaqacldaaikycnerrqfgkpigdfqmnqdmiaqmaveveaarl
    laykaaaakdegrlnngldvamakyaageavskcanyamrilgaygysteypvarfyrda
    ptyymvegsanickmiialdqlgvrkanrk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3mpjE (E:)
    mdfnlskelqmlqkevrnfvnkkivpfadqwdnenhfpyeeavrpmgelgffgtvipeey
    ggegmdqgwlaamivteeiargssalrvqlnmevlgcaytiltygsealkkkyvpklssa
    eflggfgitepdagsdvmamsstaedkgdhwllngsktwisnaaqadvliyyaytdkaag
    srglsafvieprnfpgiktsnleklgshasptgelfldnvkvpkenilgkpgdgarivfg
    slnhtrlsaaaggvglaqacldaaikycnerrqfgkpigdfqmnqdmiaqmaveveaarl
    laykaaaakdegrlnngldvamakyaageavskcanyamrilgaygysteypvarfyrda
    ptyymvegsanickmiialdqlgvrkanrkghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mpjE (E:)
    mdfnlskelqmlqkevrnfvnkkivpfadqwdnenhfpyeeavrpmgelgffgtvipeey
    ggegmdqgwlaamivteeiargssalrvqlnmevlgcaytiltygsealkkkyvpklssa
    eflggfgitepdagsdvmamsstaedkgdhwllngsktwisnaaqadvliyyaytdkaag
    srglsafvieprnfpgiktsnleklgshasptgelfldnvkvpkenilgkpgdgarivfg
    slnhtrlsaaaggvglaqacldaaikycnerrqfgkpigdfqmnqdmiaqmaveveaarl
    laykaaaakdegrlnngldvamakyaageavskcanyamrilgaygysteypvarfyrda
    ptyymvegsanickmiialdqlgvrkanrkg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3mpjF (F:)
    mdfnlskelqmlqkevrnfvnkkivpfadqwdnenhfpyeeavrpmgelgffgtvipeey
    ggegmdqgwlaamivteeiargssalrvqlnmevlgcaytiltygsealkkkyvpklssa
    eflggfgitepdagsdvmamsstaedkgdhwllngsktwisnaaqadvliyyaytdkaag
    srglsafvieprnfpgiktsnleklgshasptgelfldnvkvpkenilgkpgdgarivfg
    slnhtrlsaaaggvglaqacldaaikycnerrqfgkpigdfqmnqdmiaqmaveveaarl
    laykaaaakdegrlnngldvamakyaageavskcanyamrilgaygysteypvarfyrda
    ptyymvegsanickmiialdqlgvrkanrkghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mpjF (F:)
    mdfnlskelqmlqkevrnfvnkkivpfadqwdnenhfpyeeavrpmgelgffgtvipeey
    ggegmdqgwlaamivteeiargssalrvqlnmevlgcaytiltygsealkkkyvpklssa
    eflggfgitepdagsdvmamsstaedkgdhwllngsktwisnaaqadvliyyaytdkaag
    srglsafvieprnfpgiktsnleklgshasptgelfldnvkvpkenilgkpgdgarivfg
    slnhtrlsaaaggvglaqacldaaikycnerrqfgkpigdfqmnqdmiaqmaveveaarl
    laykaaaakdegrlnngldvamakyaageavskcanyamrilgaygysteypvarfyrda
    ptyymvegsanickmiialdqlgvrkanrk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3mpjG (G:)
    mdfnlskelqmlqkevrnfvnkkivpfadqwdnenhfpyeeavrpmgelgffgtvipeey
    ggegmdqgwlaamivteeiargssalrvqlnmevlgcaytiltygsealkkkyvpklssa
    eflggfgitepdagsdvmamsstaedkgdhwllngsktwisnaaqadvliyyaytdkaag
    srglsafvieprnfpgiktsnleklgshasptgelfldnvkvpkenilgkpgdgarivfg
    slnhtrlsaaaggvglaqacldaaikycnerrqfgkpigdfqmnqdmiaqmaveveaarl
    laykaaaakdegrlnngldvamakyaageavskcanyamrilgaygysteypvarfyrda
    ptyymvegsanickmiialdqlgvrkanrkghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mpjG (G:)
    mdfnlskelqmlqkevrnfvnkkivpfadqwdnenhfpyeeavrpmgelgffgtvipeey
    ggegmdqgwlaamivteeiargssalrvqlnmevlgcaytiltygsealkkkyvpklssa
    eflggfgitepdagsdvmamsstaedkgdhwllngsktwisnaaqadvliyyaytdkaag
    srglsafvieprnfpgiktsnleklgshasptgelfldnvkvpkenilgkpgdgarivfg
    slnhtrlsaaaggvglaqacldaaikycnerrqfgkpigdfqmnqdmiaqmaveveaarl
    laykaaaakdegrlnngldvamakyaageavskcanyamrilgaygysteypvarfyrda
    ptyymvegsanickmiialdqlgvrkanr
    

  • Chain 'Y':
    No sequence available.