PDB entry 3mpi

View 3mpi on RCSB PDB site
Description: Structure of the glutaryl-coenzyme A dehydrogenase glutaryl-CoA complex
Class: oxidoreductase
Keywords: alpha-beta fold, DEHYDROGENASE, OXIDOREDUCTASE
Deposited on 2010-04-27, released 2010-08-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-08-18, with a file datestamp of 2010-08-13.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.178
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutaryl-CoA dehydrogenase
    Species: Desulfococcus multivorans [TaxId:897]
    Gene: acd, gi228015642
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3UVB0 (0-388)
      • expression tag (389-390)
    Domains in SCOPe 2.07: d3mpia1, d3mpia2, d3mpia3
  • Chain 'B':
    Compound: Glutaryl-CoA dehydrogenase
    Species: Desulfococcus multivorans [TaxId:897]
    Gene: acd, gi228015642
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3UVB0 (0-388)
      • expression tag (389)
    Domains in SCOPe 2.07: d3mpib1, d3mpib2, d3mpib3
  • Chain 'C':
    Compound: Glutaryl-CoA dehydrogenase
    Species: Desulfococcus multivorans [TaxId:897]
    Gene: acd, gi228015642
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3UVB0 (0-388)
      • expression tag (389-394)
    Domains in SCOPe 2.07: d3mpic1, d3mpic2, d3mpic3
  • Chain 'D':
    Compound: Glutaryl-CoA dehydrogenase
    Species: Desulfococcus multivorans [TaxId:897]
    Gene: acd, gi228015642
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3UVB0 (0-388)
      • expression tag (389)
    Domains in SCOPe 2.07: d3mpid1, d3mpid2, d3mpid3
  • Heterogens: FAD, GRA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mpiA (A:)
    mdfnlskelqmlqkevrnfvnkkivpfadqwdnenhfpyeeavrpmgelgffgtvipeey
    ggegmdqgwlaamivteeiargssalrvqlnmevlgcaytiltygsealkkkyvpklssa
    eflggfgitepdagsdvmamsstaedkgdhwllngsktwisnaaqadvliyyaytdkaag
    srglsafvieprnfpgiktsnleklgshasptgelfldnvkvpkenilgkpgdgarivfg
    slnhtrlsaaaggvglaqacldaaikycnerrqfgkpigdfqmnqdmiaqmaveveaarl
    laykaaaakdegrlnngldvamakyaageavskcanyamrilgaygysteypvarfyrda
    ptyymvegsanickmiialdqlgvrkanrkghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mpiA (A:)
    mdfnlskelqmlqkevrnfvnkkivpfadqwdnenhfpyeeavrpmgelgffgtvipeey
    ggegmdqgwlaamivteeiargssalrvqlnmevlgcaytiltygsealkkkyvpklssa
    eflggfgitepdagsdvmamsstaedkgdhwllngsktwisnaaqadvliyyaytdkaag
    srglsafvieprnfpgiktsnleklgshasptgelfldnvkvpkenilgkpgdgarivfg
    slnhtrlsaaaggvglaqacldaaikycnerrqfgkpigdfqmnqdmiaqmaveveaarl
    laykaaaakdegrlnngldvamakyaageavskcanyamrilgaygysteypvarfyrda
    ptyymvegsanickmiialdqlgvrkanrkg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mpiB (B:)
    mdfnlskelqmlqkevrnfvnkkivpfadqwdnenhfpyeeavrpmgelgffgtvipeey
    ggegmdqgwlaamivteeiargssalrvqlnmevlgcaytiltygsealkkkyvpklssa
    eflggfgitepdagsdvmamsstaedkgdhwllngsktwisnaaqadvliyyaytdkaag
    srglsafvieprnfpgiktsnleklgshasptgelfldnvkvpkenilgkpgdgarivfg
    slnhtrlsaaaggvglaqacldaaikycnerrqfgkpigdfqmnqdmiaqmaveveaarl
    laykaaaakdegrlnngldvamakyaageavskcanyamrilgaygysteypvarfyrda
    ptyymvegsanickmiialdqlgvrkanrkghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mpiB (B:)
    mdfnlskelqmlqkevrnfvnkkivpfadqwdnenhfpyeeavrpmgelgffgtvipeey
    ggegmdqgwlaamivteeiargssalrvqlnmevlgcaytiltygsealkkkyvpklssa
    eflggfgitepdagsdvmamsstaedkgdhwllngsktwisnaaqadvliyyaytdkaag
    srglsafvieprnfpgiktsnleklgshasptgelfldnvkvpkenilgkpgdgarivfg
    slnhtrlsaaaggvglaqacldaaikycnerrqfgkpigdfqmnqdmiaqmaveveaarl
    laykaaaakdegrlnngldvamakyaageavskcanyamrilgaygysteypvarfyrda
    ptyymvegsanickmiialdqlgvrkanrk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3mpiC (C:)
    mdfnlskelqmlqkevrnfvnkkivpfadqwdnenhfpyeeavrpmgelgffgtvipeey
    ggegmdqgwlaamivteeiargssalrvqlnmevlgcaytiltygsealkkkyvpklssa
    eflggfgitepdagsdvmamsstaedkgdhwllngsktwisnaaqadvliyyaytdkaag
    srglsafvieprnfpgiktsnleklgshasptgelfldnvkvpkenilgkpgdgarivfg
    slnhtrlsaaaggvglaqacldaaikycnerrqfgkpigdfqmnqdmiaqmaveveaarl
    laykaaaakdegrlnngldvamakyaageavskcanyamrilgaygysteypvarfyrda
    ptyymvegsanickmiialdqlgvrkanrkghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mpiC (C:)
    mdfnlskelqmlqkevrnfvnkkivpfadqwdnenhfpyeeavrpmgelgffgtvipeey
    ggegmdqgwlaamivteeiargssalrvqlnmevlgcaytiltygsealkkkyvpklssa
    eflggfgitepdagsdvmamsstaedkgdhwllngsktwisnaaqadvliyyaytdkaag
    srglsafvieprnfpgiktsnleklgshasptgelfldnvkvpkenilgkpgdgarivfg
    slnhtrlsaaaggvglaqacldaaikycnerrqfgkpigdfqmnqdmiaqmaveveaarl
    laykaaaakdegrlnngldvamakyaageavskcanyamrilgaygysteypvarfyrda
    ptyymvegsanickmiialdqlgvrkanrkghhhh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3mpiD (D:)
    mdfnlskelqmlqkevrnfvnkkivpfadqwdnenhfpyeeavrpmgelgffgtvipeey
    ggegmdqgwlaamivteeiargssalrvqlnmevlgcaytiltygsealkkkyvpklssa
    eflggfgitepdagsdvmamsstaedkgdhwllngsktwisnaaqadvliyyaytdkaag
    srglsafvieprnfpgiktsnleklgshasptgelfldnvkvpkenilgkpgdgarivfg
    slnhtrlsaaaggvglaqacldaaikycnerrqfgkpigdfqmnqdmiaqmaveveaarl
    laykaaaakdegrlnngldvamakyaageavskcanyamrilgaygysteypvarfyrda
    ptyymvegsanickmiialdqlgvrkanrkghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mpiD (D:)
    mdfnlskelqmlqkevrnfvnkkivpfadqwdnenhfpyeeavrpmgelgffgtvipeey
    ggegmdqgwlaamivteeiargssalrvqlnmevlgcaytiltygsealkkkyvpklssa
    eflggfgitepdagsdvmamsstaedkgdhwllngsktwisnaaqadvliyyaytdkaag
    srglsafvieprnfpgiktsnleklgshasptgelfldnvkvpkenilgkpgdgarivfg
    slnhtrlsaaaggvglaqacldaaikycnerrqfgkpigdfqmnqdmiaqmaveveaarl
    laykaaaakdegrlnngldvamakyaageavskcanyamrilgaygysteypvarfyrda
    ptyymvegsanickmiialdqlgvrkanrk