PDB entry 3mo1

View 3mo1 on RCSB PDB site
Description: Crystal structure of the non-neutralizing HIV antibody 13H11 Fab fragment
Class: immune system
Keywords: HIV-1, HIV, gp41 MPER, 13H11, 2F5, Z13, 4E10, Fab antibody, IMMUNE SYSTEM
Deposited on 2010-04-22, released 2010-11-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-01-28, with a file datestamp of 2015-01-23.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.189
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: anti-hiv-1 antibody 13h11 light chain
    Species: Mus musculus,Homo sapiens [TaxId:10090,9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MO1
    Domains in SCOPe 2.07: d3mo1a1, d3mo1a2
  • Chain 'B':
    Compound: anti-hiv-1 antibody 13h11 heavy chain
    Species: Mus musculus,Homo sapiens [TaxId:10090,9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MO1 (0-End)
  • Heterogens: ACT, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mo1A (A:)
    rldiqltqspsslamsggqkvtmrckssqsllnsrnernylawyqqkpgqspkllvyfas
    iresgvpdrfigsgsgtdftltissvqaedladyfclqhyntpwtfgggtkleikrtvaa
    psvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdst
    yslsstltlskadyekhkvyacevthqglsspvtksfnrgecgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mo1A (A:)
    ldiqltqspsslamsggqkvtmrckssqsllnsrnernylawyqqkpgqspkllvyfasi
    resgvpdrfigsgsgtdftltissvqaedladyfclqhyntpwtfgggtkleikrtvaap
    svfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdsty
    slsstltlskadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'B':
    No sequence available.