PDB entry 3mnv

View 3mnv on RCSB PDB site
Description: Crystal structure of the non-neutralizing HIV antibody 13H11 Fab fragment
Class: immune system
Keywords: HIV-1, HIV, gp41, MPER, 13H11, 2F5, Z13, 4E10, Fab antibody, IMMUNE SYSTEM
Deposited on 2010-04-22, released 2010-11-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-04-20, with a file datestamp of 2011-04-15.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.183
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: anti-hiv-1 antibody 13h11 light chain
    Species: Mus musculus,Homo sapiens [TaxId:10090,9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MNV (0-114)
    • Uniprot Q8TCD0 (115-End)
    Domains in SCOPe 2.06: d3mnva1, d3mnva2
  • Chain 'B':
    Compound: anti-hiv-1 antibody 13h11 heavy chain
    Species: Mus musculus,Homo sapiens [TaxId:10090,9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6N089 (114-214)
    • PDB 3MNV (0-113)
  • Chain 'C':
    Compound: anti-hiv-1 antibody 13h11 light chain
    Species: Mus musculus,Homo sapiens [TaxId:10090,9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MNV (0-114)
    • Uniprot Q8TCD0 (115-End)
    Domains in SCOPe 2.06: d3mnvc1, d3mnvc2
  • Chain 'D':
    Compound: anti-hiv-1 antibody 13h11 heavy chain
    Species: Mus musculus,Homo sapiens [TaxId:10090,9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6N089 (114-214)
    • PDB 3MNV (Start-113)
  • Heterogens: SO4, EDO, CL, NO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mnvA (A:)
    rldiqltqspsslamsggqkvtmrckssqsllnsrnernylawyqqkpgqspkllvyfas
    iresgvpdrfigsgsgtdftltissvqaedladyfclqhyntpwtfgggtkleikrtvaa
    psvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdst
    yslsstltlskadyekhkvyacevthqglsspvtksfnrgecgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mnvA (A:)
    rldiqltqspsslamsggqkvtmrckssqsllnsrnernylawyqqkpgqspkllvyfas
    iresgvpdrfigsgsgtdftltissvqaedladyfclqhyntpwtfgggtkleikrtvaa
    psvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdst
    yslsstltlskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3mnvC (C:)
    rldiqltqspsslamsggqkvtmrckssqsllnsrnernylawyqqkpgqspkllvyfas
    iresgvpdrfigsgsgtdftltissvqaedladyfclqhyntpwtfgggtkleikrtvaa
    psvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdst
    yslsstltlskadyekhkvyacevthqglsspvtksfnrgecgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mnvC (C:)
    rldiqltqspsslamsggqkvtmrckssqsllnsrnernylawyqqkpgqspkllvyfas
    iresgvpdrfigsgsgtdftltissvqaedladyfclqhyntpwtfgggtkleikrtvaa
    psvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdst
    yslsstltlskadyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'D':
    No sequence available.