PDB entry 3mn0

View 3mn0 on RCSB PDB site
Description: Introducing a 2-His-1-Glu Non-Heme Iron Center into Myoglobin confers Nitric Oxide Reductase activity: Cu(II)-CN-FeBMb(-His) form
Class: metal binding protein
Keywords: Alpha Helix, Heme, Cyanide, metal-binding, NO reductase, METAL BINDING PROTEIN
Deposited on 2010-04-20, released 2010-08-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-08-18, with a file datestamp of 2010-08-13.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.245
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Gene: MB, pMbt7-7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (0-152)
      • engineered (28)
      • engineered (42)
    Domains in SCOPe 2.08: d3mn0a_
  • Heterogens: HEM, CU, CYN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3mn0A (A:)
vlsegewqlvlhvwakveadvaghgqdieirlfkshpetlekhdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg