PDB entry 3ml5

View 3ml5 on RCSB PDB site
Description: Crystal structure of the C183S/C217S mutant of human CA VII in complex with acetazolamide
Class: lyase
Keywords: Protein-inhibitor complex, LYASE
Deposited on 2010-04-16, released 2011-03-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-03-02, with a file datestamp of 2011-02-25.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.166
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbonic anhydrase 7
    Species: Homo sapiens [TaxId:9606]
    Gene: CA7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43166 (Start-268)
      • engineered mutation (189)
      • engineered mutation (223)
    Domains in SCOPe 2.06: d3ml5a_
  • Heterogens: ZN, AZM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ml5A (A:)
    gspnsmtghhgwgygqddgpshwhklypiaqgdrqspiniissqavyspslqplelsyea
    cmslsitnnghsvqvdfndsddrtvvtggplegpyrlkqfhfhwgkkhdvgsehtvdgks
    fpselhlvhwnakkystfgeaasapdglavvgvfletgdehpsmnrltdalymvrfkgtk
    aqfscfnpksllpasrhywtypgslttpplsesvtwivlrepisiserqmgkfrsllfts
    edderihmvnnfrppqplkgrvvkasfra
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ml5A (A:)
    ghhgwgygqddgpshwhklypiaqgdrqspiniissqavyspslqplelsyeacmslsit
    nnghsvqvdfndsddrtvvtggplegpyrlkqfhfhwgkkhdvgsehtvdgksfpselhl
    vhwnakkystfgeaasapdglavvgvfletgdehpsmnrltdalymvrfkgtkaqfscfn
    pksllpasrhywtypgslttpplsesvtwivlrepisiserqmgkfrsllftsedderih
    mvnnfrppqplkgrvvkasfra