PDB entry 3miw

View 3miw on RCSB PDB site
Description: Crystal Structure of Rotavirus NSP4
Class: viral protein
Keywords: rotavirus enterotoxin, non structural protein, nsp4, pentameric coiled coil, virulence, viral protein
Deposited on 2010-04-12, released 2011-05-25
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-07-25, with a file datestamp of 2012-07-20.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.264
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Non-structural glycoprotein 4
    Species: Human rotavirus G4 [TaxId:10960]
    Gene: G10
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q82035 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.04: d3miwa_
  • Chain 'B':
    Compound: Non-structural glycoprotein 4
    Species: Human rotavirus G4 [TaxId:10960]
    Gene: G10
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q82035 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.04: d3miwb_
  • Chain 'C':
    Compound: Non-structural glycoprotein 4
    Species: Human rotavirus G4 [TaxId:10960]
    Gene: G10
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q82035 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.04: d3miwc_
  • Chain 'D':
    Compound: Non-structural glycoprotein 4
    Species: Human rotavirus G4 [TaxId:10960]
    Gene: G10
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q82035 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.04: d3miwd_
  • Chain 'E':
    Compound: Non-structural glycoprotein 4
    Species: Human rotavirus G4 [TaxId:10960]
    Gene: G10
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q82035 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.04: d3miwe_
  • Chain 'F':
    Compound: Non-structural glycoprotein 4
    Species: Human rotavirus G4 [TaxId:10960]
    Gene: G10
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q82035 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.04: d3miwf_
  • Chain 'G':
    Compound: Non-structural glycoprotein 4
    Species: Human rotavirus G4 [TaxId:10960]
    Gene: G10
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q82035 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.04: d3miwg_
  • Chain 'H':
    Compound: Non-structural glycoprotein 4
    Species: Human rotavirus G4 [TaxId:10960]
    Gene: G10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3miwh_
  • Chain 'I':
    Compound: Non-structural glycoprotein 4
    Species: Human rotavirus G4 [TaxId:10960]
    Gene: G10
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q82035 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.04: d3miwi_
  • Chain 'J':
    Compound: Non-structural glycoprotein 4
    Species: Human rotavirus G4 [TaxId:10960]
    Gene: G10
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q82035 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.04: d3miwj_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3miwA (A:)
    mieqqmdrivkemrrqlemidklttreieqiellkrihdnlitrpvnvidmsm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3miwA (A:)
    mieqqmdrivkemrrqlemidklttreieqiellkrihdnlit
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3miwB (B:)
    mieqqmdrivkemrrqlemidklttreieqiellkrihdnlitrpvnvidmsm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3miwB (B:)
    mieqqmdrivkemrrqlemidklttreieqiellkrihdnlitr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3miwC (C:)
    mieqqmdrivkemrrqlemidklttreieqiellkrihdnlitrpvnvidmsm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3miwC (C:)
    mieqqmdrivkemrrqlemidklttreieqiellkrihdnlitrpv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3miwD (D:)
    mieqqmdrivkemrrqlemidklttreieqiellkrihdnlitrpvnvidmsm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3miwD (D:)
    mieqqmdrivkemrrqlemidklttreieqiellkrihdnlitrp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3miwE (E:)
    mieqqmdrivkemrrqlemidklttreieqiellkrihdnlitrpvnvidmsm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3miwE (E:)
    mieqqmdrivkemrrqlemidklttreieqiellkrihdnlitr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3miwF (F:)
    mieqqmdrivkemrrqlemidklttreieqiellkrihdnlitrpvnvidmsm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3miwF (F:)
    mieqqmdrivkemrrqlemidklttreieqiellkrihdnlitr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3miwG (G:)
    mieqqmdrivkemrrqlemidklttreieqiellkrihdnlitrpvnvidmsm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3miwG (G:)
    mieqqmdrivkemrrqlemidklttreieqiellkrihdnl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3miwH (H:)
    mieqqmdrivkemrrqlemidklttreieqiellkrihdnlitrpvnvidmsm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3miwH (H:)
    ieqqmdrivkemrrqlemidklttreieqiellkrihdnl
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3miwI (I:)
    mieqqmdrivkemrrqlemidklttreieqiellkrihdnlitrpvnvidmsm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3miwI (I:)
    mieqqmdrivkemrrqlemidklttreieqiellkrihdnlit
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3miwJ (J:)
    mieqqmdrivkemrrqlemidklttreieqiellkrihdnlitrpvnvidmsm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3miwJ (J:)
    mieqqmdrivkemrrqlemidklttreieqiellkrihdnli