PDB entry 3mi0

View 3mi0 on RCSB PDB site
Description: Crystal Structure of Mycobacterium Tuberculosis Proteasome at 2.2 A
Class: hydrolase
Keywords: Enzyme Inhibitors, Lactones, Proteasome Endopeptidase Complex, Mycobacterium tuberculosis, HYDROLASE
Deposited on 2010-04-09, released 2010-06-23
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-06-23, with a file datestamp of 2010-06-18.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.205
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2169, prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3mi01_
  • Chain '2':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3mi02_
  • Chain 'A':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2169, prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3mi0a_
  • Chain 'B':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2169, prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3mi0b_
  • Chain 'C':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3mi0c_
  • Chain 'D':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2169, prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3mi0d_
  • Chain 'E':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3mi0e_
  • Chain 'F':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2169, prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3mi0f_
  • Chain 'G':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3mi0g_
  • Chain 'H':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3mi0h_
  • Chain 'I':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2169, prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3mi0i_
  • Chain 'J':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3mi0j_
  • Chain 'K':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2169, prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3mi0k_
  • Chain 'L':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3mi0l_
  • Chain 'M':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2169, prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3mi0m_
  • Chain 'N':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3mi0n_
  • Chain 'O':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2169, prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3mi0o_
  • Chain 'P':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3mi0p_
  • Chain 'Q':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2169, prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3mi0q_
  • Chain 'R':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245 (0-233)
      • expression tag (234-238)
    Domains in SCOPe 2.01: d3mi0r_
  • Chain 'S':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2169, prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3mi0s_
  • Chain 'T':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3mi0t_
  • Chain 'U':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2169, prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3mi0u_
  • Chain 'V':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245 (0-233)
      • expression tag (234-238)
    Domains in SCOPe 2.01: d3mi0v_
  • Chain 'W':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2169, prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3mi0w_
  • Chain 'X':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3mi0x_
  • Chain 'Y':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2169, prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3mi0y_
  • Chain 'Z':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3mi0z_
  • Heterogens: DMF, SA6, HOH

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >3mi01 (1:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mi01 (1:)
    speqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagk
    fnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaev
    ahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaa
    lralgvaslevavldanrprrafrritgsalqall
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >3mi02 (2:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mi02 (2:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsg
    

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mi0A (A:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mi0A (A:)
    speqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagk
    fnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaev
    ahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaa
    lraggvaslevavldanrprrafrritgsalqall
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mi0B (B:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mi0B (B:)
    ispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaag
    kfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvae
    vahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriava
    alragaslevavldanrprrafrritgsalqal
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3mi0C (C:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mi0C (C:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3mi0D (D:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mi0D (D:)
    speqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagk
    fnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaev
    ahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaa
    lragvaslevavldanrprrafrritgsalqall
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3mi0E (E:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mi0E (E:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3mi0F (F:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mi0F (F:)
    yfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaa
    agkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcv
    aevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalria
    vaalragslgvaslevavldanrprrafrritgsalqall
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3mi0G (G:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mi0G (G:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3mi0H (H:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mi0H (H:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3mi0I (I:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mi0I (I:)
    fispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaa
    gkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcva
    evahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriav
    aalralgvaslevavldanrprrafrritgsalqal
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3mi0J (J:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mi0J (J:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3mi0K (K:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mi0K (K:)
    ispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaag
    kfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvae
    vahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriava
    alralgvaslevavldanrprrafrritgsalqall
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3mi0L (L:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mi0L (L:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsg
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3mi0M (M:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mi0M (M:)
    ispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaag
    kfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvae
    vahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriava
    alralgvaslevavldanrprrafrritgsalqall
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3mi0N (N:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mi0N (N:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3mi0O (O:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mi0O (O:)
    ispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaag
    kfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvae
    vahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriava
    alralgvaslevavldanrprrafrritgsalqall
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3mi0P (P:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mi0P (P:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >3mi0Q (Q:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mi0Q (Q:)
    ispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaag
    kfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvae
    vahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriava
    alragvaslevavldanrprrafrritgsalqall
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3mi0R (R:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mi0R (R:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhh
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >3mi0S (S:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mi0S (S:)
    ispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaag
    kfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvae
    vahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriava
    alragvaslevavldanrprrafrritgsalqallv
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >3mi0T (T:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mi0T (T:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsg
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >3mi0U (U:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mi0U (U:)
    ispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaag
    kfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvae
    vahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriava
    alraggvaslevavldanrprrafrritgsalqall
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >3mi0V (V:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mi0V (V:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhh
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >3mi0W (W:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mi0W (W:)
    fispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaa
    gkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcva
    evahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriav
    aalragvaslevavldanrprrafrritgsalqall
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3mi0X (X:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mi0X (X:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsg
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >3mi0Y (Y:)
    msfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrv
    gfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyev
    elcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltda
    lriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqesp
    qsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mi0Y (Y:)
    ispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaag
    kfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvae
    vahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriava
    alralgvaslevavldanrprrafrritgsalqall
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >3mi0Z (Z:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mi0Z (Z:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsg