PDB entry 3mgw

View 3mgw on RCSB PDB site
Description: Thermodynamics and structure of a salmon cold-active goose-type lysozyme
Class: hydrolase
Keywords: Salmon, goose-type, lysozyme, differential scanning calorimetry, refolding, thermal tolerance, innate immunity, HYDROLASE
Deposited on 2010-04-07, released 2010-05-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Lysozyme g
  Species: Salmo salar [TaxId:8030]
  Gene: lysG, LYG
  Database cross-references and differences (RAF-indexed):
  • Uniprot A6PZ97 (2-180)
    • expression tag (0-1)
    • see remark 999 (128)
  Domains in SCOPe 2.07: d3mgwa1, d3mgwa2
• Heterogens: CO, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3mgwA (A:)
  hhditkvdtsgaseitarqdkltlqgvdashklaehdlvrmnkykelitrvgqkhgldpa
  iiagiisresragsaldhgwgdhgkgfglmqvdkryhkivgawdsekhisqgteiliefi
  rriqakfpvwpkehqlkggisaynagdknvrtyermdvgttggdysndvvarsqwfksqg
  y