PDB entry 3mg0

View 3mg0 on RCSB PDB site
Description: Structure of yeast 20S proteasome with bortezomib
Class: hydrolase
Keywords: 20S proteasome, HYDROLASE
Deposited on 2010-04-05, released 2011-05-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-05-18, with a file datestamp of 2011-05-13.
Experiment type: XRAY
Resolution: 2.68 Å
R-factor: 0.227
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: Proteasome component PRE4
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3mg01_
  • Chain '2':
    Compound: Proteasome component PRE3
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3mg02_
  • Chain 'A':
    Compound: Proteasome component Y7
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3mg0a_
  • Chain 'B':
    Compound: Proteasome component Y13
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3mg0b_
  • Chain 'C':
    Compound: Proteasome component PRE6
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3mg0c_
  • Chain 'D':
    Compound: Proteasome component PUP2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3mg0d_
  • Chain 'E':
    Compound: Proteasome component PRE5
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3mg0e_
  • Chain 'F':
    Compound: Proteasome component C1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3mg0f_
  • Chain 'G':
    Compound: Proteasome component C7-alpha
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3mg0g_
  • Chain 'H':
    Compound: Proteasome component PUP1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3mg0h_
  • Chain 'I':
    Compound: Proteasome component PUP3
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3mg0i_
  • Chain 'J':
    Compound: Proteasome component C11
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3mg0j_
  • Chain 'K':
    Compound: Proteasome component PRE2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3mg0k_
  • Chain 'L':
    Compound: Proteasome component C5
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3mg0l_
  • Chain 'M':
    Compound: Proteasome component PRE4
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3mg0m_
  • Chain 'N':
    Compound: Proteasome component PRE3
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3mg0n_
  • Chain 'O':
    Compound: Proteasome component Y7
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3mg0o_
  • Chain 'P':
    Compound: Proteasome component Y13
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3mg0p_
  • Chain 'Q':
    Compound: Proteasome component PRE6
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3mg0q_
  • Chain 'R':
    Compound: Proteasome component PUP2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3mg0r_
  • Chain 'S':
    Compound: Proteasome component PRE5
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3mg0s_
  • Chain 'T':
    Compound: Proteasome component C1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3mg0t_
  • Chain 'U':
    Compound: Proteasome component C7-alpha
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3mg0u_
  • Chain 'V':
    Compound: Proteasome component PUP1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3mg0v_
  • Chain 'W':
    Compound: Proteasome component PUP3
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3mg0w_
  • Chain 'X':
    Compound: Proteasome component C11
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3mg0x_
  • Chain 'Y':
    Compound: Proteasome component PRE2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3mg0y_
  • Chain 'Z':
    Compound: Proteasome component C5
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3mg0z_
  • Heterogens: BO2, HOH

PDB Chain Sequences:

  • Chain '1':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mg01 (1:)
    tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
    qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
    sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
    mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki
    

  • Chain '2':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mg02 (2:)
    tsimavtfkdgvilgadsrtttgayianrvtdkltrvhdkiwccrsgsaadtqaiadivq
    yhlelytsqygtpstetaasvfkelcyenkdnltagiivagyddknkgevytiplggsvh
    klpyaiagsgstfiygycdknfrenmskeetvdfikhslsqaikwdgssggvirmvvlta
    agverlifypdeyeql
    

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mg0A (A:)
    mtdrysfslttfspsgklgqidyaltavkqgvtslgikatngvviatekksssplamset
    lskvslltpdigavysgmgpdyrvlvdksrkvahtsykriygeypptkllvsevakimqe
    atqsggvrpfgvslliaghdefngfslyqvdpsgsyfpwkataigkgsvaaktflekrwn
    deleledaihialltlkesvegefngdtielaiigdenpdllgytgiptdkgprfrklts
    qeindrleal
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mg0B (B:)
    gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
    steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
    ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
    ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
    tgit
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mg0C (C:)
    gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
    kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
    sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
    eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe
    q
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mg0D (D:)
    drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
    eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
    geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
    ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
    ae
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mg0E (E:)
    frnnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyqk
    kiikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqkntq
    syggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfik
    idgnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mg0F (F:)
    gtgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqkn
    vkiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqaht
    lynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhp
    eglsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaq
    kein
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mg0G (G:)
    agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv
    syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt
    qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks
    kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia
    eqd
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mg0H (H:)
    ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
    snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
    vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
    gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mg0I (I:)
    sdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdvt
    tlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpfi
    agfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdals
    gwgavvyiikkdevvkrylkmrqd
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mg0J (J:)
    mdiilgirvqdsvilasskavtrgisvlkdsddktrqlsphtlmsfageagdtvqfaeyi
    qaniqlysiredyelspqavssfvrqelaksirsrrpyqvnvliggydkkknkpelyqid
    ylgtkvelpygahgysgfytfslldhhyrpdmtteegldllklcvqelekrmpmdfkgvi
    vkivdkdgirqvddfqaq
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mg0K (K:)
    tttlafrfqggiivavdsratagnwvasqtvkkvieinpfllgtmaggaadcqfwetwlg
    sqcrlhelrekerisvaaaskilsnlvyqykgaglsmgtmicgytrkegptiyyvdsdgt
    rlkgdifcvgsgqtfaygvldsnykwdlsvedalylgkrsilaaahrdaysggsvnlyhv
    tedgwiyhgnhdvgelfwkvkeeegsfnnvig
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mg0L (L:)
    qfnpygdnggtilgiagedfavlagdtrnitdysinsryepkvfdcgdnivmsangfaad
    gdalvkrfknsvkwyhfdhndkklsinsaarniqhllygkrffpyyvhtiiagldedgkg
    avysfdpvgsyereqcraggaaaslimpfldnqvnfknqyepgtngkvkkplkylsveev
    iklvrdsftsaterhiqvgdgleilivtkdgvrkefyelkrd
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mg0M (M:)
    tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
    qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
    sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
    mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mg0N (N:)
    tsimavtfkdgvilgadsrtttgayianrvtdkltrvhdkiwccrsgsaadtqaiadivq
    yhlelytsqygtpstetaasvfkelcyenkdnltagiivagyddknkgevytiplggsvh
    klpyaiagsgstfiygycdknfrenmskeetvdfikhslsqaikwdgssggvirmvvlta
    agverlifypdeyeql
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mg0O (O:)
    mtdrysfslttfspsgklgqidyaltavkqgvtslgikatngvviatekksssplamset
    lskvslltpdigavysgmgpdyrvlvdksrkvahtsykriygeypptkllvsevakimqe
    atqsggvrpfgvslliaghdefngfslyqvdpsgsyfpwkataigkgsvaaktflekrwn
    deleledaihialltlkesvegefngdtielaiigdenpdllgytgiptdkgprfrklts
    qeindrleal
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mg0P (P:)
    gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
    steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
    ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
    ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
    tgit
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mg0Q (Q:)
    gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
    kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
    sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
    eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe
    q
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mg0R (R:)
    drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
    eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
    geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
    ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
    ae
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mg0S (S:)
    frnnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyqk
    kiikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqkntq
    syggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfik
    idgnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mg0T (T:)
    gtgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqkn
    vkiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqaht
    lynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhp
    eglsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaq
    kein
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mg0U (U:)
    agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv
    syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt
    qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks
    kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia
    eqd
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mg0V (V:)
    ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
    snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
    vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
    gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd
    

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mg0W (W:)
    sdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdvt
    tlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpfi
    agfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdals
    gwgavvyiikkdevvkrylkmrqd
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mg0X (X:)
    mdiilgirvqdsvilasskavtrgisvlkdsddktrqlsphtlmsfageagdtvqfaeyi
    qaniqlysiredyelspqavssfvrqelaksirsrrpyqvnvliggydkkknkpelyqid
    ylgtkvelpygahgysgfytfslldhhyrpdmtteegldllklcvqelekrmpmdfkgvi
    vkivdkdgirqvddfqaq
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mg0Y (Y:)
    tttlafrfqggiivavdsratagnwvasqtvkkvieinpfllgtmaggaadcqfwetwlg
    sqcrlhelrekerisvaaaskilsnlvyqykgaglsmgtmicgytrkegptiyyvdsdgt
    rlkgdifcvgsgqtfaygvldsnykwdlsvedalylgkrsilaaahrdaysggsvnlyhv
    tedgwiyhgnhdvgelfwkvkeeegsfnnvig
    

  • Chain 'Z':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mg0Z (Z:)
    qfnpygdnggtilgiagedfavlagdtrnitdysinsryepkvfdcgdnivmsangfaad
    gdalvkrfknsvkwyhfdhndkklsinsaarniqhllygkrffpyyvhtiiagldedgkg
    avysfdpvgsyereqcraggaaaslimpfldnqvnfknqyepgtngkvkkplkylsveev
    iklvrdsftsaterhiqvgdgleilivtkdgvrkefyelkrd