PDB entry 3mfe

View 3mfe on RCSB PDB site
Description: Crystal Structure of Mycobacterium Tuberculosis Proteasome open-gate mutant with H0 movement
Class: hydrolase
Keywords: Catalytic Domain, Hydrogen Bonding, Mycobacterium tuberculosis, Oxazolidinones, Protease Inhibitors, Proteasome Endopeptidase Complex, Protein Carbonylation, Protein Conformation, Protein Subunits, Substrate Specificity, Thiazoles, helix movement, HYDROLASE
Deposited on 2010-04-02, released 2010-06-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-06-23, with a file datestamp of 2010-06-18.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.224
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2169, prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mfe1_
  • Chain '2':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245 (1-End)
      • amidation (0)
    Domains in SCOPe 2.07: d3mfe2_
  • Chain 'A':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2169, prcA, Rv2109c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33244 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d3mfea_
  • Chain 'B':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2169, prcA, Rv2109c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33244 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d3mfeb_
  • Chain 'C':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245 (1-End)
      • amidation (0)
    Domains in SCOPe 2.07: d3mfec_
  • Chain 'D':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2169, prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mfed_
  • Chain 'E':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245 (1-End)
      • amidation (0)
    Domains in SCOPe 2.07: d3mfee_
  • Chain 'F':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2169, prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mfef_
  • Chain 'G':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mfeg_
  • Chain 'H':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245 (1-End)
      • amidation (0)
    Domains in SCOPe 2.07: d3mfeh_
  • Chain 'I':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2169, prcA, Rv2109c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33244 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d3mfei_
  • Chain 'J':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245 (1-End)
      • amidation (0)
    Domains in SCOPe 2.07: d3mfej_
  • Chain 'K':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2169, prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mfek_
  • Chain 'L':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245 (1-End)
      • amidation (0)
    Domains in SCOPe 2.07: d3mfel_
  • Chain 'M':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2169, prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mfem_
  • Chain 'N':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245 (1-End)
      • amidation (0)
    Domains in SCOPe 2.07: d3mfen_
  • Chain 'O':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2169, prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mfeo_
  • Chain 'P':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245 (1-End)
      • amidation (0)
    Domains in SCOPe 2.07: d3mfep_
  • Chain 'Q':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2169, prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mfeq_
  • Chain 'R':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245 (1-End)
      • amidation (0)
    Domains in SCOPe 2.07: d3mfer_
  • Chain 'S':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2169, prcA, Rv2109c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33244 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d3mfes_
  • Chain 'T':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245 (1-End)
      • amidation (0)
    Domains in SCOPe 2.07: d3mfet_
  • Chain 'U':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2169, prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mfeu_
  • Chain 'V':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mfev_
  • Chain 'W':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2169, prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mfew_
  • Chain 'X':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245 (1-End)
      • amidation (0)
    Domains in SCOPe 2.07: d3mfex_
  • Chain 'Y':
    Compound: Proteasome subunit alpha
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2169, prcA, Rv2109c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mfey_
  • Chain 'Z':
    Compound: Proteasome subunit beta
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT2170, prcB, Rv2110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33245 (1-End)
      • amidation (0)
    Domains in SCOPe 2.07: d3mfez_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >3mfe1 (1:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mfe1 (1:)
    eqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkfn
    efdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaevah
    ygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaalr
    agsvaslevavldanrprrafrritgsalqall
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >3mfe2 (2:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mfe2 (2:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mfeA (A:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mfeA (A:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsvaslevavldanrprrafrritgsalqall
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mfeB (B:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mfeB (B:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsgvaslevavldanrprrafrritgsalqallv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3mfeC (C:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mfeC (C:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3mfeD (D:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mfeD (D:)
    eqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkfn
    efdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaevah
    ygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaalr
    agsvaslevavldanrprrafrritgsalqall
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3mfeE (E:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mfeE (E:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3mfeF (F:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mfeF (F:)
    qamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkfne
    fdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaevahy
    getkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaalra
    gsvaslevavldanrprrafrritgsalqall
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3mfeG (G:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mfeG (G:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3mfeH (H:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mfeH (H:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3mfeI (I:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mfeI (I:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragslgvaslevavldanrprrafrritgsalqallv
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3mfeJ (J:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mfeJ (J:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3mfeK (K:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mfeK (K:)
    eqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkfn
    efdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaevah
    ygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaalr
    agslgvaslevavldanrprrafrritgsalqallv
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3mfeL (L:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mfeL (L:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3mfeM (M:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mfeM (M:)
    aksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkfnefdnlrrggiqfadtrg
    yaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaevahygetkrpelyritydgs
    iadephfvvmggttepianalkesyaenasltdalriavaalragsvaslevavldanrp
    rrafrritgsalqa
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3mfeN (N:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mfeN (N:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3mfeO (O:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mfeO (O:)
    eqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkfn
    efdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaevah
    ygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaalr
    agsvaslevavldanrprrafrritgsalqallv
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3mfeP (P:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mfeP (P:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >3mfeQ (Q:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mfeQ (Q:)
    eqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkfn
    efdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaevah
    ygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaalr
    agsvaslevavldanrprrafrritgsalqall
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3mfeR (R:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mfeR (R:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >3mfeS (S:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mfeS (S:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsvaslevavldanrprrafrritgsalqallv
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >3mfeT (T:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mfeT (T:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >3mfeU (U:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mfeU (U:)
    eqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkfn
    efdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaevah
    ygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaalr
    agvaslevavldanrprrafrritgsalqall
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >3mfeV (V:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mfeV (V:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsga
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >3mfeW (W:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mfeW (W:)
    rerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkfnefdn
    lrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaevahyget
    krpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaalragsv
    aslevavldanrprrafrritgsalqall
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3mfeX (X:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mfeX (X:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >3mfeY (Y:)
    meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
    nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
    hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
    ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdqespqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mfeY (Y:)
    eqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkfn
    efdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaevah
    ygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaalr
    agsvaslevavldanrprrafrritgsalqall
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >3mfeZ (Z:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mfeZ (Z:)
    xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs