PDB entry 3mdj

View 3mdj on RCSB PDB site
Description: ER Aminopeptidase, ERAP1, Bound to the Zinc Aminopeptidase Inhibitor, Bestatin
Class: Hydrolase/Hydrolase Inhibitor
Keywords: aminopeptidase, Zn binding protein, ER, Hydrolase-Hydrolase Inhibitor complex
Deposited on 2010-03-30, released 2011-03-30
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-27, with a file datestamp of 2011-07-22.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.202
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoplasmic reticulum aminopeptidase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ERAP1, APPILS, ARTS1, KIAA0525, UNQ584/PRO1154
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NZ08
      • see remark 999 (309)
      • see remark 999 (491)
      • see remark 999 (693)
    Domains in SCOPe 2.05: d3mdja1, d3mdja2, d3mdja3, d3mdja4
  • Chain 'B':
    Compound: endoplasmic reticulum aminopeptidase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ERAP1, APPILS, ARTS1, KIAA0525, UNQ584/PRO1154
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NZ08
      • see remark 999 (309)
      • see remark 999 (491)
      • see remark 999 (693)
    Domains in SCOPe 2.05: d3mdjb1, d3mdjb2, d3mdjb3, d3mdjb4
  • Chain 'C':
    Compound: endoplasmic reticulum aminopeptidase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ERAP1, APPILS, ARTS1, KIAA0525, UNQ584/PRO1154
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NZ08
      • see remark 999 (309)
      • see remark 999 (491)
      • see remark 999 (693)
    Domains in SCOPe 2.05: d3mdjc1, d3mdjc2, d3mdjc3, d3mdjc4
  • Heterogens: ZN, BES, NAG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mdjA (A:)
    aspkrsdgtpfpwnkirlpeyvipvhydllihanlttltfwgttkveitasqptstiilh
    shhlqisratlrkgagerlseeplqvlehprqeqiallapepllvglpytvvihyagnls
    etfhgfykstyrtkegelrilastqfeptaarmafpcfdepafkasfsikirreprhlai
    snmplvksvtvaegliedhfdvtvkmstylvafiisdfesvskitksgvkvsvyavpdki
    nqadyaldaavtllefyedyfsipyplpkqdlaaipdfqsgamenwglttyresallfda
    ekssassklditmtvahelahqwfgnlvtmewwndlwlnegfakfmefvsvsvthpelkv
    gdyffgkcfdamevdalnsshpvstpvenpaqiremfddvsydkgacilnmlreylsada
    fksgivqylqkhsykntknedlwdsmasicptdgvkgmdgfcsrsqhssssshwhqervd
    vktmmntwtlqrgfplititvrgrnvhmkqehymkgsdgapdtgylwhvpltfitsksdm
    vhrfllktktdvlilpeevewikfnvgmngyyivhyeddgwdsltgllkgthtavssndr
    aslinnafqlvsigklsiekaldlslylkheteimpvfqglnelipmyklmekrdmneve
    tqfkaflirllrdlidkqtwtdegsvsermlrsellllacvhnyqpcvqraegyfrkwke
    sngnlslpvdvtlavfavgaqstegwdflyskyqfslssteksqiefalcrtqnkeklqw
    lldesfkgdkiktqefpqiltligrnpvgyplawqflrknwnklvqkfelgsssiahmvm
    gttnqfstrtrleevkgffsslkengsqlrcvqqtietieenigwmdknfdkirvwlqse
    klehdpeadatglermlesrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mdjA (A:)
    pfpwnkirlpeyvipvhydllihanlttltfwgttkveitasqptstiilhshhlqisra
    tlrkgrlseeplqvlehprqeqiallapepllvglpytvvihyagnlsetfhgfykstyr
    tkegelrilastqfeptaarmafpcfdepafkasfsikirreprhlaisnmplvksvtva
    egliedhfdvtvkmstylvafiisdfesvskitksgvkvsvyavpdkinqadyaldaavt
    llefyedyfsipyplpkqdlaaipdfqsgamenwglttyresallfdaekssasskldit
    mtvahelahqwfgnlvtmewwndlwlnegfakfmefvsvsvthpelkvgdyffgkcfdam
    evdalnssddvsydkgacilnmlreylsadafksgivqylqkhsykntknedlwdsmasi
    vdvktmmntwtlqrgfplititvrgrnvhmkqehymkapdtgylwhvpltfitsksdmvh
    rfllktktdvlilpeevewikfnvgmngyyivhyeddgwdsltgllkgthtavssndras
    linnafqlvsigklsiekaldlslylkheteimpvfqglnelipmyklmekrdmnevetq
    fkaflirllrdlidkqtwtdegsvsermlrsellllacvhnyqpcvqraegyfrkwkesn
    gnlslpvdvtlavfavgaqstegwdflyskyqfslssteksqiefalcrtqnkeklqwll
    desfkgdkiktqefpqiltligrnpvgyplawqflrknwnklvqksssiahmvmgttnqf
    strtrleevkcvqqtietieenigwmdknfdkirvwlq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mdjB (B:)
    aspkrsdgtpfpwnkirlpeyvipvhydllihanlttltfwgttkveitasqptstiilh
    shhlqisratlrkgagerlseeplqvlehprqeqiallapepllvglpytvvihyagnls
    etfhgfykstyrtkegelrilastqfeptaarmafpcfdepafkasfsikirreprhlai
    snmplvksvtvaegliedhfdvtvkmstylvafiisdfesvskitksgvkvsvyavpdki
    nqadyaldaavtllefyedyfsipyplpkqdlaaipdfqsgamenwglttyresallfda
    ekssassklditmtvahelahqwfgnlvtmewwndlwlnegfakfmefvsvsvthpelkv
    gdyffgkcfdamevdalnsshpvstpvenpaqiremfddvsydkgacilnmlreylsada
    fksgivqylqkhsykntknedlwdsmasicptdgvkgmdgfcsrsqhssssshwhqervd
    vktmmntwtlqrgfplititvrgrnvhmkqehymkgsdgapdtgylwhvpltfitsksdm
    vhrfllktktdvlilpeevewikfnvgmngyyivhyeddgwdsltgllkgthtavssndr
    aslinnafqlvsigklsiekaldlslylkheteimpvfqglnelipmyklmekrdmneve
    tqfkaflirllrdlidkqtwtdegsvsermlrsellllacvhnyqpcvqraegyfrkwke
    sngnlslpvdvtlavfavgaqstegwdflyskyqfslssteksqiefalcrtqnkeklqw
    lldesfkgdkiktqefpqiltligrnpvgyplawqflrknwnklvqkfelgsssiahmvm
    gttnqfstrtrleevkgffsslkengsqlrcvqqtietieenigwmdknfdkirvwlqse
    klehdpeadatglermlesrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mdjB (B:)
    pfpwnkirlpeyvipvhydllihanlttltfwgttkveitasqptstiilhshhlqisra
    tlrkgagerlseeplqvlehprqeqiallapepllvglpytvvihyagnlsetfhgfyks
    tyrtkegelrilastqfeptaarmafpcfdepafkasfsikirreprhlaisnmplvksv
    tvaegliedhfdvtvkmstylvafiisdfesvskitksgvkvsvyavpdkinqadyalda
    avtllefyedyfsipyplpkqdlaaipdfqsgamenwglttyresallfdaekssasskl
    ditmtvahelahqwfgnlvtmewwndlwlnegfakfmefvsvsvthpelkvgdyffgkcf
    damevdalnssddvsydkgacilnmlreylsadafksgivqylqkhsykntknedlwdsm
    asivdvktmmntwtlqrgfplititvrgrnvhmkqehymkapdtgylwhvpltfitsksd
    mvhrfllktktdvlilpeevewikfnvgmngyyivhyeddgwdsltgllkgthtavssnd
    raslinnafqlvsigklsiekaldlslylkheteimpvfqglnelipmyklmekrdmnev
    etqfkaflirllrdlidkqtwtdegsvsermlrsellllacvhnyqpcvqraegyfrkwk
    esngnlslpvdvtlavfavgaqstegwdflyskyqfslssteksqiefalcrtqnkeklq
    wlldesfkgdkiktqefpqiltligrnpvgyplawqflrknwnklvqksssiahmvmgtt
    nqfstrtrleevkcvqqtietieenigwmdknfdkirvwlq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3mdjC (C:)
    aspkrsdgtpfpwnkirlpeyvipvhydllihanlttltfwgttkveitasqptstiilh
    shhlqisratlrkgagerlseeplqvlehprqeqiallapepllvglpytvvihyagnls
    etfhgfykstyrtkegelrilastqfeptaarmafpcfdepafkasfsikirreprhlai
    snmplvksvtvaegliedhfdvtvkmstylvafiisdfesvskitksgvkvsvyavpdki
    nqadyaldaavtllefyedyfsipyplpkqdlaaipdfqsgamenwglttyresallfda
    ekssassklditmtvahelahqwfgnlvtmewwndlwlnegfakfmefvsvsvthpelkv
    gdyffgkcfdamevdalnsshpvstpvenpaqiremfddvsydkgacilnmlreylsada
    fksgivqylqkhsykntknedlwdsmasicptdgvkgmdgfcsrsqhssssshwhqervd
    vktmmntwtlqrgfplititvrgrnvhmkqehymkgsdgapdtgylwhvpltfitsksdm
    vhrfllktktdvlilpeevewikfnvgmngyyivhyeddgwdsltgllkgthtavssndr
    aslinnafqlvsigklsiekaldlslylkheteimpvfqglnelipmyklmekrdmneve
    tqfkaflirllrdlidkqtwtdegsvsermlrsellllacvhnyqpcvqraegyfrkwke
    sngnlslpvdvtlavfavgaqstegwdflyskyqfslssteksqiefalcrtqnkeklqw
    lldesfkgdkiktqefpqiltligrnpvgyplawqflrknwnklvqkfelgsssiahmvm
    gttnqfstrtrleevkgffsslkengsqlrcvqqtietieenigwmdknfdkirvwlqse
    klehdpeadatglermlesrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mdjC (C:)
    pfpwnkirlpeyvipvhydllihanlttltfwgttkveitasqptstiilhshhlqisra
    tlrkgerlseeplqvlehprqeqiallapepllvglpytvvihyagnlsetfhgfyksty
    rtkegelrilastqfeptaarmafpcfdepafkasfsikirreprhlaisnmplvksvtv
    aegliedhfdvtvkmstylvafiisdfesvskitksgvkvsvyavpdkinqadyaldaav
    tllefyedyfsipyplpkqdlaaipdfqsgamenwglttyresallfdaekssasskldi
    tmtvahelahqwfgnlvtmewwndlwlnegfakfmefvsvsvthpelkvgdyffgkcfda
    mevdalnssddvsydkgacilnmlreylsadafksgivqylqkhsykntknedlwdsmas
    ivdvktmmntwtlqrgfplititvrgrnvhmkqehymkapdtgylwhvpltfitsksdmv
    hrfllktktdvlilpeevewikfnvgmngyyivhyeddgwdsltgllkgthtavssndra
    slinnafqlvsigklsiekaldlslylkheteimpvfqglnelipmyklmekrdmnevet
    qfkaflirllrdlidkqtwtdegsvsermlrsellllacvhnyqpcvqraegyfrkwkes
    ngnlslpvdvtlavfavgaqstegwdflyskyqfslssteksqiefalcrtqnkeklqwl
    ldesfkgdkiktqefpqiltligrnpvgyplawqflrknwnklvqksssiahmvmgttnq
    fstrtrleevkcvqqtietieenigwmdknfdkirvwlq