PDB entry 3md9

View 3md9 on RCSB PDB site
Description: Structure of apo form of a periplasmic heme binding protein
Class: transport protein
Keywords: transport protein, alpha beta protein, rigid helical backbone, substrate-free, heme transport, Iron transport
Deposited on 2010-03-30, released 2010-09-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-02-23, with a file datestamp of 2011-02-18.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.154
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemin-binding periplasmic protein hmuT
    Species: Yersinia pestis [TaxId:632]
    Gene: hmuT, YPO0281, y0541, YP_0436
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3md9a_
  • Chain 'B':
    Compound: Hemin-binding periplasmic protein hmuT
    Species: Yersinia pestis [TaxId:632]
    Gene: hmuT, YPO0281, y0541, YP_0436
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3md9b_
  • Heterogens: BR, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3md9A (A:)
    maerivtiggdvteiayalgagdeivardstsqqpqaaqklpdvgymrtlnaegilamkp
    tmllvselaqpslvltqiassgvnvvtvpgqttpesvamkinavatalhqtekgqklied
    yqqrlaavnktplpvkvlfvmshggltpmaagqntaadamiraaggsnamqgfsryrpls
    qegviasapdlllittdgvkalgsseniwklpgmaltpagkhkrllvvddmallgfglet
    pqvlaqlrekmeqmq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3md9A (A:)
    aerivtiggdvteiayalgagdeivardstsqqpqaaqklpdvgymrtlnaegilamkpt
    mllvselaqpslvltqiassgvnvvtvpgqttpesvamkinavatalhqtekgqkliedy
    qqrlaavnktplpvkvlfvmshggltpmaagqntaadamiraaggsnamqgfsryrplsq
    egviasapdlllittdgvkalgsseniwklpgmaltpagkhkrllvvddmallgfgletp
    qvlaqlrekmeqm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3md9B (B:)
    maerivtiggdvteiayalgagdeivardstsqqpqaaqklpdvgymrtlnaegilamkp
    tmllvselaqpslvltqiassgvnvvtvpgqttpesvamkinavatalhqtekgqklied
    yqqrlaavnktplpvkvlfvmshggltpmaagqntaadamiraaggsnamqgfsryrpls
    qegviasapdlllittdgvkalgsseniwklpgmaltpagkhkrllvvddmallgfglet
    pqvlaqlrekmeqmq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3md9B (B:)
    aerivtiggdvteiayalgagdeivardstsqqpqaaqklpdvgymrtlnaegilamkpt
    mllvselaqpslvltqiassgvnvvtvpgqttpesvamkinavatalhqtekgqkliedy
    qqrlaavnktplpvkvlfvmshggltpmaagqntaadamiraaggsnamqgfsryrplsq
    egviasapdlllittdgvkalgsseniwklpgmaltpagkhkrllvvddmallgfgletp
    qvlaqlrekmeqm