PDB entry 3md1

View 3md1 on RCSB PDB site
Description: Crystal Structure of the Second RRM Domain of Yeast Poly(U)-Binding Protein (Pub1)
Class: RNA binding protein
Keywords: RRM, RBD, RNP, poly(U) binding, Pub1, Nucleus, RNA-binding, RNA BINDING PROTEIN
Deposited on 2010-03-29, released 2010-05-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.199
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32588 (0-79)
      • expression tag (80-82)
    Domains in SCOPe 2.07: d3md1a1, d3md1a2
  • Chain 'B':
    Compound: Nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3md1b_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3md1A (A:)
    tfnlfvgdlnvnvddetlrnafkdfpsylsghvmwdmqtgssrgygfvsftsqddaqnam
    dsmqgqdlngrplrinwaakleh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3md1B (B:)
    tfnlfvgdlnvnvddetlrnafkdfpsylsghvmwdmqtgssrgygfvsftsqddaqnam
    dsmqgqdlngrplrinwaakleh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3md1B (B:)
    tfnlfvgdlnvnvddetlrnafkdfpsylsghvmwdmqtgssrgygfvsftsqddaqnam
    dsmqgqdlngrplrinwaa