PDB entry 3md0

View 3md0 on RCSB PDB site
Description: Crystal structure of arginine/ornithine transport system ATPase from Mycobacterium tuberculosis bound to GDP (a RAS-like GTPase superfamily protein)
Class: transport protein
Keywords: Seattle Structural Genomics Center for Infectious Disease, RAS, RAS-like GTPase, allosteric modulator, tuberculosis, ATP-binding, Nucleotide-binding, SSGCID, TRANSPORT PROTEIN
Deposited on 2010-03-29, released 2010-04-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-06-03, with a file datestamp of 2015-05-29.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Arginine/ornithine transport system ATPase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: Rv1496
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3md0a_
  • Heterogens: GDP, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3md0A (A:)
    mahhhhhhmgtleaqtqgpgsmmaashdddtvdglatavrggdraalpraitlvestrpd
    hreqaqqlllrllpdsgnahrvgitgvpgvgkstaiealgmhlierghrvavlavdpsst
    rtggsilgdktrmarlavhpnayirpsptsgtlggvtratretvvlleaagfdvilietv
    gvgqsevavanmvdtfvlltlartgdqlqgikkgvleladivvvnkadgehhkearlaar
    elsaairliyprealwrppvltmsavegrglaelwdtverhrqvltgagefdarrrdqqv
    dwtwqlvrdavldrvwsnptvrkvrselerrvrageltpalaaqqileianltdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3md0A (A:)
    tvdglatavrggdraalpraitlvestrpdhreqaqqlllrllpdsgnahrvgitgvpgv
    gkstaiealgmhlierghrvavlavrmarlavhpnayirpstlggvtratretvvlleaa
    gfdvilietgqsevavanmvdtfvlltlartgdqlqgikkgvleladivvvnkadgehhk
    earlaarelsaairliyprealwrppvltmsavegrglaelwdtverhrqvltgagefda
    rrrdqqvdwtwqlvrdavldrvwsnptvrkvrselerrvrageltpalaaqqileianlt
    d