PDB entry 3mca

View 3mca on RCSB PDB site
Description: Structure of the Dom34-Hbs1 Complex and implications for its role in No-Go decay
Class: Translation regulation/HYDROLASE
Keywords: protein protein complex, Translation regulation, No-Go Decay, Translation regulation-HYDROLASE complex
Deposited on 2010-03-28, released 2010-10-06
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-10-20, with a file datestamp of 2010-10-15.
Experiment type: XRAY
Resolution: 2.74 Å
R-factor: 0.249
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elongation factor 1 alpha-like protein
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Protein dom34
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3mcab1, d3mcab2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mcaB (B:)
    mkliqkniekngsgwitmcpeepedmwhlynilqvgdqlkastvrrvvkvgatgstsgsr
    vvmklrilvenmdfdtkaaqlhikgrtteyhpevkmgsyhtldlelhrnftlyknewdaf
    aldrvdaacnpsrnaeigavvldeglaniclitdymtilrqridqviprkrrgdssayqk
    gldkfydsvfqsinsefdfdklkvvilaspgfvarglydyifsmavkldlkqivksknkf
    vilhsstghihslneilkdpaveskladtkyvqeirvlnkfydvmneddrkawygpnhvl
    kafelgaigellisdslfrssdiatrkkwvslvegvkeincpvyifsslhesgkqldlls
    giaailtypvdeedisedeedeesqnfehs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mcaB (B:)
    ieknsgwitmepedmwhlynilqvgdqlkastvrrilvenmdfdtkaaqlhikrtteyhp
    mgsyhtldlelhrnftlynewdafaldrvdaacnpsaeigavvldeglaniclitdymti
    lrqridqviprkrrgdssayqkgldkfydsvfqsinsefdfdklkvvilaspgfvargly
    dyifsmavkldlkqivksknkfvilhsstghihslneilkdpaveskladtkyvqeirvl
    nkfydvmneddrkawygpnhvlkafelgaigellisdslfrssdiatrkkwvslvegvke
    incpvyifsslhesgkqldllsgiaailtypvdeedisede