PDB entry 3mbe

View 3mbe on RCSB PDB site
Description: TCR 21.30 in complex with MHC class II I-Ag7HEL(11-27)
Class: immune system
Keywords: T cell receptor, Histocompatability antigen, MHC class II, I-Ag7, IMMUNE SYSTEM
Deposited on 2010-03-25, released 2010-05-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-05-15, with a file datestamp of 2013-05-10.
Experiment type: XRAY
Resolution: 2.89 Å
R-factor: 0.254
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MHC CLASS II H2-IAg7 ALPHA CHAIN
    Species: Mus musculus [TaxId:10090]
    Gene: H2-Aa
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04228 (Start-181)
      • expression tag (182-185)
  • Chain 'B':
    Compound: MHC CLASS II H2-IAg7 BETA CHAIN
    Species: Mus musculus [TaxId:10090]
    Gene: H2-Ab1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q31135 (Start-192)
      • expression tag (193)
  • Chain 'C':
    Compound: TCR 21.3 alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: H2-Ab1
    Database cross-references and differences (RAF-indexed):
    • PDB 3MBE
  • Chain 'D':
    Compound: TCR 21.3 beta chain
    Species: Mus musculus [TaxId:10090]
    Gene: H2-Ab1
    Database cross-references and differences (RAF-indexed):
    • PDB 3MBE
    Domains in SCOPe 2.07: d3mbed1, d3mbed2
  • Chain 'E':
    Compound: MHC CLASS II H2-IAg7 ALPHA CHAIN
    Species: Mus musculus [TaxId:10090]
    Gene: H2-Aa
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04228 (Start-181)
      • expression tag (182-185)
  • Chain 'F':
    Compound: MHC CLASS II H2-IAg7 BETA CHAIN
    Species: Mus musculus [TaxId:10090]
    Gene: H2-Ab1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q31135 (Start-192)
      • expression tag (193)
    Domains in SCOPe 2.07: d3mbef1, d3mbef2, d3mbef3
  • Chain 'G':
    Compound: TCR 21.3 alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: H2-Ab1
    Database cross-references and differences (RAF-indexed):
    • PDB 3MBE
  • Chain 'H':
    Compound: TCR 21.3 beta chain
    Species: Mus musculus [TaxId:10090]
    Gene: H2-Ab1
    Database cross-references and differences (RAF-indexed):
    • PDB 3MBE
  • Chain 'P':
    Compound: peptide HEL 11-27
    Species: Gallus gallus, synthetic [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00698 (0-End)
      • conflict (0)
  • Chain 'Q':
    Compound: peptide HEL 11-27
    Species: Gallus gallus, synthetic [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00698 (0-End)
      • conflict (0)
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3mbeD (D:)
    eaavtqsprskvavtggkvtlschqtnnhdymywyrqdtghglrlihysyvadstekgdi
    pdgykasrpsqenfslilelaslsqtavyfcasswdragntlyfgegsrlivvedlrnvt
    ppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvctdpqaykesn
    ysyslssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaeawgradc
    gitsasyhqssadlvprgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mbeD (D:)
    avtqsprskvavtggkvtlschqtnnhdymywyrqdtghglrlihysyvadstekgdipd
    gykasrpsqenfslilelaslsqtavyfcasswdragntlyfgegsrlivvedlrnvtpp
    kvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvctdpqaykesnys
    yslssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaeawgra
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3mbeF (F:)
    gsgsgsgdserhfvhqfkgecyftngtqrirlvtryiynreeylrfdsdvgeyravtelg
    rhsaeyynkqylertraeldtacrhnyeetevptslrrleqpnvaislsrtealnhhntl
    vcsvtdfypakikvrwfrngqeetvgvsstqlirngdwtfqvlvmlemtphqgevytchv
    ehpslkspitvewssadlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mbeF (F:)
    rhfvhqfkgecyftngtqrirlvtryiynreeylrfdsdvgeyravtelgrhsaeyynkq
    ylertraeldtacrhnyeetevptslrrleqpnvaislsrhntlvcsvtdfypakikvrw
    frngqeetvgvsstqlirngdwtfqvlvmlemtphqgevytchvehpslkspitvews
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.