PDB entry 3ma9

View 3ma9 on RCSB PDB site
Description: Crystal structure of gp41 derived protein complexed with fab 8066
Class: immune system
Keywords: gp41, immune system
Deposited on 2010-03-23, released 2010-12-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transmembrane glycoprotein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Fab8066 FAB ANTIBODY FRAGMENT, Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MA9
  • Chain 'L':
    Compound: Fab8066 FAB ANTIBODY FRAGMENT, Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MA9
    Domains in SCOPe 2.07: d3ma9l1, d3ma9l2
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3ma9L (L:)
    dieltqppsvsvvpgqtariscsgdnipyeyaswyqqkpgqapvlviygdnnrpsgiper
    fsgsnsgntatltisgtqaedeadyycaswdsmtvdgvfgggtkltvlgqpkaapsvtlf
    ppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyl
    sltpeqwkshrsyscqvthegstvektvaptea
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ma9L (L:)
    ieltqppsvsvvpgqtariscsgdnipyeyaswyqqkpgqapvlviygdnnrpsgiperf
    sgsnsgntatltisgtqaedeadyycaswdsmtvdgvfgggtkltvlgqpkaapsvtlfp
    psseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyls
    ltpeqwkshrsyscqvthegstvektvap