PDB entry 3m9q

View 3m9q on RCSB PDB site
Description: Drosophila MSL3 chromodomain
Class: DNA binding protein
Keywords: Chromodomain, MSL3, methyllysine recognition, aromatic cage, MSL complex, transcription upregulation, DNA BINDING PROTEIN
Deposited on 2010-03-22, released 2010-07-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.29 Å
R-factor: N/A
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein male-specific lethal-3
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: msl-3, CG8631
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50536 (Start-100)
      • engineered mutation (74)
    Domains in SCOPe 2.07: d3m9qa_
  • Chain 'B':
    Compound: Protein male-specific lethal-3
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: msl-3, CG8631
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50536
      • engineered mutation (74)
    Domains in SCOPe 2.07: d3m9qb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3m9qA (A:)
    mkkhhhhhhmtelrdetplfhkgeivlcyepdkskarvlytskvlnvferrnehglrfye
    ykihfqgwrpsydravratvllkdteenrqlqrelaeaakl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m9qA (A:)
    lrdetplfhkgeivlcyepdkskarvlytskvlnvferrnehglrfyeykihfqgwrpsy
    dravratvllkdteenrqlqrelaeaakl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3m9qB (B:)
    mkkhhhhhhmtelrdetplfhkgeivlcyepdkskarvlytskvlnvferrnehglrfye
    ykihfqgwrpsydravratvllkdteenrqlqrelaeaakl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m9qB (B:)
    lrdetplfhkgeivlcyepdkskarvlytskvlnvferrnehglrfyeykihfqgwrpsy
    dravratvllkdteenrqlqrelaeaa