PDB entry 3m9k

View 3m9k on RCSB PDB site
Description: Crystal structure of human thioredoxin C69/73S double-mutant, oxidized form
Class: oxidoreductase
Keywords: dimer, intermolecular disulfide bond, DTT, disulfide bond, S-nitrosylation, OXIDOREDUCTASE
Deposited on 2010-03-22, released 2010-08-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-12-08, with a file datestamp of 2010-12-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.185
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin
    Species: Homo sapiens [TaxId:9606]
    Gene: TXN, TRDX, TRX, TRX1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10599 (0-104)
      • engineered (68)
      • engineered (72)
    Domains in SCOPe 2.07: d3m9ka_
  • Chain 'B':
    Compound: thioredoxin
    Species: Homo sapiens [TaxId:9606]
    Gene: TXN, TRDX, TRX, TRX1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10599 (0-104)
      • engineered (68)
      • engineered (72)
    Domains in SCOPe 2.07: d3m9kb_
  • Heterogens: SO4, D1D, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3m9kA (A:)
    mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd
    dcqdvasesevksmptfqffkkgqkvgefsgankekleatinelv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3m9kB (B:)
    mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd
    dcqdvasesevksmptfqffkkgqkvgefsgankekleatinelv