PDB entry 3m9j

View 3m9j on RCSB PDB site
Description: Crystal structure of human thioredoxin C69/73S double mutant, reduced form
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2010-03-22, released 2010-08-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: N/A
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin
    Species: Homo sapiens [TaxId:9606]
    Gene: TXN, TRDX, TRX, TRX1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10599 (0-104)
      • engineered (68)
      • engineered (72)
    Domains in SCOPe 2.07: d3m9ja_
  • Chain 'B':
    Compound: thioredoxin
    Species: Homo sapiens [TaxId:9606]
    Gene: TXN, TRDX, TRX, TRX1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10599 (0-104)
      • engineered (68)
      • engineered (72)
    Domains in SCOPe 2.07: d3m9jb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3m9jA (A:)
    mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd
    dcqdvasesevksmptfqffkkgqkvgefsgankekleatinelv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3m9jB (B:)
    mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd
    dcqdvasesevksmptfqffkkgqkvgefsgankekleatinelv