PDB entry 3m8v

View 3m8v on RCSB PDB site
Description: Crystal structure of the BTB domain from Kaiso/ZBTB33, form II
Class: transcription
Keywords: Activator, DNA-binding, Metal-binding, Nucleus, Phosphoprotein, Repressor, Transcription, Transcription regulation, Wnt signaling pathway, Zinc-finger
Deposited on 2010-03-19, released 2011-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-03-02, with a file datestamp of 2011-02-25.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.203
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator Kaiso
    Species: Homo sapiens [TaxId:9606]
    Gene: KAISO, ZBTB33, ZNF348
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3m8va_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3m8vA (A:)
    gsmesrklisatdiqysgsllnslneqrghglfcdvtvivedrkfrahknilsasstyfh
    qlfsvagqvvelsfiraeifaeilnyiysskivrvrsdlldeliksgqllgvkfiaelgv
    plsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m8vA (A:)
    rklisatdiqysgsllnslneqrghglfcdvtvivedrkfrahknilsasstyfhqlfsv
    agqvvelsfiraeifaeilnyiysskivrvrsdlldeliksgqllgvkfiaelg