PDB entry 3m7s

View 3m7s on RCSB PDB site
Description: Crystal structure of the complex of xylanase GH-11 and alpha amylase inhibitor protein with cellobiose at 2.4 A resolution
Class: protein binding
Keywords: TIM barrel, PROTEIN BINDING
Deposited on 2010-03-17, released 2010-05-05
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-09-07, with a file datestamp of 2011-09-02.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.196
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Haementhin
    Species: Scadoxus multiflorus [TaxId:82246]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3m7sa_
  • Heterogens: PO4, CBI, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3m7sA (A:)
anldiavywgqnfdersleatcdtgnyayviigflntfgggqtpaldisghspsglepqi
khcqsknvkvllsiggpkgpysldsrsdandlavylfnnfllppghsenrpfgnavldgi
dfhiehggpsqyqllanilssfrlagtefaltaapqcvypdpnlgtvinsatfdaiwvqf
ynnpqcsyssgnaealmnawrewsmkartkkvflgfpahpdaagsgymppekvkfhvfpa
akksykfggimlwdsywdtvsnfsskilgegw