PDB entry 3m7q
View 3m7q on RCSB PDB site
Description: Crystal structure of recombinant Kunitz Type serine protease Inhibitor-1 from the Caribbean sea anemone stichodactyla helianthus in complex with bovine pancreatic trypsin
Class: Hydrolase/Hydrolase inhibitor
Keywords: Trypsin-Inhibitor complex, Kunitz-type serine-protease inhibitor, Digestion, Disulfide bond, Hydrolase, Metal-binding, Protease, Secreted, Serine protease, Zymogen, Nematocyst, Protease inhibitor, Serine protease inhibitor, Hydrolase-Hydrolase inhibitor complex
Deposited on
2010-03-17, released
2011-03-16
The last revision prior to the SCOPe 2.07 freeze date was dated
2012-11-14, with a file datestamp of
2012-11-09.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.159
AEROSPACI score: 0.58
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: cationic trypsin
Species: Bos taurus [TaxId:9913]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d3m7qa_ - Chain 'B':
Compound: Kunitz-type proteinase inhibitor SHPI-1
Species: Stichodactyla helianthus [TaxId:6123]
Database cross-references and differences (RAF-indexed):
- Uniprot P31713 (4-58)
- expression tag (0-3)
- expression tag (59-60)
Domains in SCOPe 2.07: d3m7qb1, d3m7qb2, d3m7qb3 - Heterogens: PO4, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3m7qA (A:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3m7qB (B:)
eaeasicsepkkvgrckgyfprfyfdsetgkctpfiyggcggngnnfetlhqcraicral
g