PDB entry 3m7q

View 3m7q on RCSB PDB site
Description: Crystal structure of recombinant Kunitz Type serine protease Inhibitor-1 from the Caribbean sea anemone stichodactyla helianthus in complex with bovine pancreatic trypsin
Class: Hydrolase/Hydrolase inhibitor
Keywords: Trypsin-Inhibitor complex, Kunitz-type serine-protease inhibitor, Digestion, Disulfide bond, Hydrolase, Metal-binding, Protease, Secreted, Serine protease, Zymogen, Nematocyst, Protease inhibitor, Serine protease inhibitor, Hydrolase-Hydrolase inhibitor complex
Deposited on 2010-03-17, released 2011-03-16
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-11-14, with a file datestamp of 2012-11-09.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.159
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cationic trypsin
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00760 (0-222)
  Domains in SCOPe 2.03: d3m7qa_
• Chain 'B':
  Compound: Kunitz-type proteinase inhibitor SHPI-1
  Species: Stichodactyla helianthus [TaxId:6123]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P31713 (4-58)
    • expression tag (0-3)
    • expression tag (59-60)
  Domains in SCOPe 2.03: d3m7qb_
• Heterogens: PO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3m7qA (A:)
  ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
  neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
  wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
  vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3m7qB (B:)
  eaeasicsepkkvgrckgyfprfyfdsetgkctpfiyggcggngnnfetlhqcraicral
  g