PDB entry 3m6f

View 3m6f on RCSB PDB site
Description: CD11A I-domain complexed with 6-((5S,9R)-9-(4-CYANOPHENYL)-3-(3,5-DICHLOROPHENYL)-1-METHYL-2,4-DIOXO-1,3,7- TRIAZASPIRO[4.4]NON-7-YL)NICOTINIC ACID
Class: cell adhesion
Keywords: LFA1, INHIBITOR, Alternative splicing, Calcium, Cell adhesion, Disulfide bond, Glycoprotein, Integrin, Magnesium, Membrane, Polymorphism, Receptor, Transmembrane
Deposited on 2010-03-15, released 2010-05-12
The last revision prior to the SCOPe 2.03 freeze date was dated 2010-05-19, with a file datestamp of 2010-05-14.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.193
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Integrin alpha-L
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGAL, CD11A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20701 (4-182)
      • expression tag (3)
    Domains in SCOPe 2.03: d3m6fa_
  • Heterogens: BJZ, NO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3m6fA (A:)
    gshmnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfs
    dyvkrkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatd
    sgnidaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqk
    kiy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m6fA (A:)
    mnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdyv
    krkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgn
    idaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqkkiy