PDB entry 3m63

View 3m63 on RCSB PDB site
Description: Crystal structure of Ufd2 in complex with the ubiquitin-like (UBL) domain of Dsk2
Class: ligase/protein binding
Keywords: Armadillo-like repeats, Ubl conjugation pathway, Nucleus, Phosphoprotein, LIGASE-PROTEIN BINDING complex
Deposited on 2010-03-15, released 2010-04-28
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.21
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin conjugation factor E4
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: D1255, UFD2, YDL190C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54860 (7-End)
      • expression tag (1-6)
      • engineered (108)
      • engineered (683)
  • Chain 'B':
    Compound: Ubiquitin domain-containing protein DSK2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: DSK2, SHE4, YM8021.02, YMR276W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3m63b_
  • Heterogens: 1PE, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3m63B (B:)
    mkhhhhhhpmsdydipttenlyfqgamslnihiksgqdkwevnvapestvlqfkeainka
    ngipvanqrliysgkilkddqtvesyhiqdghsvhlvksqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m63B (B:)
    lnihiksgqdkwevnvapestvlqfkeainkangipvanqrliysgkilkddqtvesyhi
    qdghsvhlvksq