PDB entry 3m5s

View 3m5s on RCSB PDB site
Description: Carbonic Anhydrase II mutant H64C in complex with carbonate
Class: lyase
Keywords: Stranded Twisted Beta-sheets, Lyase, Disease mutation, Metal-binding
Deposited on 2010-03-13, released 2011-05-25
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-05-25, with a file datestamp of 2011-05-20.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.138
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbonic anhydrase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00918
      • engineered (68)
    Domains in SCOPe 2.03: d3m5sa_
  • Heterogens: ZN, CO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3m5sA (A:)
    gspefmshhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqat
    slrilnngcafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkya
    aelhlvhwntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadf
    tnfdprgllpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngege
    peelmvdnwrpaqplknrqikasfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3m5sA (A:)
    hhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnn
    gcafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvh
    wntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprg
    llpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvd
    nwrpaqplknrqikasf