PDB entry 3m5l

View 3m5l on RCSB PDB site
Description: Crystal structure of HCV NS3/4A protease in complex with ITMN-191
Class: hydrolase/hydrolase inhibitor
Keywords: HCV, Hepatitis C Virus, NS3, protease, drug resistance, serine protease, chimera protein, fusion protein, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2010-03-12, released 2010-11-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-12-22, with a file datestamp of 2010-12-17.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.15
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ns3/4a
  Species: Hepatitis C virus subtype 1a [TaxId:31646]
  Gene: NS3
  Database cross-references and differences (RAF-indexed):
  • Uniprot A8DG50 (10-20)
    • expression tag (2-5)
    • engineered mutation (6-9)
    • see remark 999 (11)
    • see remark 999 (18-19)
  • Uniprot A8DG50 (21-End)
    • engineered mutation (21-23)
    • engineered mutation (33-34)
    • engineered mutation (37-38)
    • engineered mutation (41)
    • engineered mutation (60)
    • engineered mutation (67)
    • engineered mutation (72)
    • engineered mutation (92)
    • engineered mutation (106)
    • engineered mutation (159)
    • engineered mutation (179)
  Domains in SCOPe 2.06: d3m5la1, d3m5la2
• Heterogens: TSV, SO4, ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3m5lA (A:)
  gshmasmkkkgsvvivgrinlsgdtayaqqtrgeegcqetsqtgrdknqvegevqivsta
  tqtflatsingvlwtvyhgagtrtiaspkgpvtqmytnvdkdlvgwqapqgsrsltpctc
  gssdlylvtrhadvipvrrrgdsrgsllsprpisylkgsaggpllcpaghavgifraavs
  trgvakavdfipveslettmrsp
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3m5lA (A:)
  hmasmkkkgsvvivgrinlsgdtayaqqtrgeegcqetsqtgrdknqvegevqivstatq
  tflatsingvlwtvyhgagtrtiaspkgpvtqmytnvdkdlvgwqapqgsrsltpctcgs
  sdlylvtrhadvipvrrrgdsrgsllsprpisylkgsaggpllcpaghavgifraavstr
  gvakavdfipveslettm